TkA03G484150 | RubberDandelionOmics

Gene overview

TkA03G484150

Reference: TK1151 Chr: Chr03 Coordinates: 121135501-121138892 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · TkA03G484150|TK1151|cDNA

ATGTCATCTGCTCTTACCCCCATCATCGTCGATTCAGTGGTCTCCGCCCCCATCATCGTCGATTCAGTGGTCTCCGCCCCCATCATCGTCGATTCGTTTGCTACGGGTAACCTAGACGCCGCCGTCACCTGTTCTCGACCACCGCGTCTGTTCTCTATCGCAGCTTCAATCGCACCTGTTCAGCGCCTCCTTCCTTCGATTTCACAGGTTAGAATTCTAAACCCCGTGATTTCGCCACTGTCCTGTACGCGACCTACCCG...

CDS

Download CDS FASTA

1173 bp · TkA03G484150|TK1151|CDS

ATGTCATCTGCTCTTACCCCCATCATCGTCGATTCAGTGGTCTCCGCCCCCATCATCGTCGATTCAGTGGTCTCCGCCCCCATCATCGTCGATTCGTTTGCTACGGGTAACCTAGACGCCGCCGTCACCTGTTCTCGACCACCGCGTCTGTTCTCTATCGCAGCTTCAATCGCACCTGTTCAGCGCCTCCTTCCTTCGATTTCACAGGTTAGAATTCTAAACCCCGTGATTTCGCCACTGTCCTGTACGCGACCTACCCG...

Protein

Download Protein FASTA

390 aa · TkA03G484150|TK1151|PROTEIN

MSSALTPIIVDSVVSAPIIVDSVVSAPIIVDSFATGNLDAAVTCSRPPRLFSIAASIAPVQRLLPSISQVRILNPVISPLSCTRPTRLPLLMRTGMLKSNMCLYVEIEQALPYLYVPCSDIVHQPDQQGDECARVISLVLERALKLKSNAGSKRQHVHDCSLVRARRLYGYDASEQLREVILKHSLVSGQPQSPQDPIVANCKHRPFLRVTTPIVDKIEELSYVRKVPGRDTTPTPQPLPNLLGKRAVNKKLIRTLRGDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G484150`
TK1151 ID	TkA03G484150
OH-1004 ID	LXL04_028879
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 45.641 / OH-1004 97.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G484150

Location Chr03:121135501-121138892 (+)

Description Similar to REV3: DNA polymerase zeta catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67500`	Catalytic subunit of the error prone DNA polymerase zeta.	Disruption of the AtREV3 gene causes hypersensitivity to ultraviolet B light and gamma-rays in Arabidopsis: implication of the presence of a translesion synthesis mechanism in plants.2003 · DOI: 10.1105/tpc.012369 Roles of Arabidopsis AtREV1 and AtREV7 in translesion synthesis.2005 · DOI: 10.1104/pp.105.060236 RAD5a and REV3 function in two alternative pathways of DNA-damage tolerance in Arabidopsis.2011 · DOI: 10.1016/j.dnarep.2011.04.009

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028879 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009411 response to UV Biological Process

GO:0010224 response to UV-B Biological Process

GO:0042276 error-prone translesion synthesis Biological Process

GO:0071494 cellular response to UV-C Biological Process

GO:0005634 nucleus Cellular Component

GO:0016035 zeta DNA polymerase complex Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.328

Rank 1 · TkA03G484150 · TK1151

Cytoplasm0.326

Rank 2 · TkA03G484150 · TK1151

Nucleus0.229

Rank 3 · TkA03G484150 · TK1151

Cell membrane0.101

Rank 4 · TkA03G484150 · TK1151

Plastid0.067

Rank 5 · TkA03G484150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22097McpB_HAMP_1st29-64 aa

PF24055POL3_N109-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G484150	`PF22097`	McpB_HAMP_1st	29	64	0.14	13.1
TkA03G484150	`PF24055`	POL3_N	109	176	2.8e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q766Z3`	Arabidopsis thaliana	sp\|Q766Z3\|REV3_ARATH DNA polymerase zeta catalytic subunit	53.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card