RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G483700
Reference: TK1151 Chr: Chr03 Coordinates: 120999139-121001087 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1785 bp · TkA03G483700|TK1151|cDNA

ATGGGGACTAAATCCGATTTAGCTCGTTTGGATGCACATGACGAGCAAATCCTGCAATTACAGTCTACTACAACAGAAATCAAGAGGAATGTAGAAGAATTCAAAGCTATTTGGGAGGCTTATCAGTTGGAGCAACTTGAGTTCCGGAAAGAGATGCTGGCTTGGATGAAGCAACATGACCCAGAATTTTTTTCATTGCCTGAATTTTATGGTGTTGATCCTCAAGGATGGATTCAAAGAGCGAACTGCTATTTTGACCT...

CDS

Download CDS FASTA

1785 bp · TkA03G483700|TK1151|CDS

ATGGGGACTAAATCCGATTTAGCTCGTTTGGATGCACATGACGAGCAAATCCTGCAATTACAGTCTACTACAACAGAAATCAAGAGGAATGTAGAAGAATTCAAAGCTATTTGGGAGGCTTATCAGTTGGAGCAACTTGAGTTCCGGAAAGAGATGCTGGCTTGGATGAAGCAACATGACCCAGAATTTTTTTCATTGCCTGAATTTTATGGTGTTGATCCTCAAGGATGGATTCAAAGAGCGAACTGCTATTTTGACCT...

Protein

Download Protein FASTA

594 aa · TkA03G483700|TK1151|PROTEIN

MGTKSDLARLDAHDEQILQLQSTTTEIKRNVEEFKAIWEAYQLEQLEFRKEMLAWMKQHDPEFFSLPEFYGVDPQGWIQRANCYFDLNGTSMVSVSMGESLRTPVLGEVGLVCSNTPPFEDEDEVKLVVSESESKSNTTPPIRLLPFIPAPLPLMTLKAESGKTSGLVPYQGGMREKFNSLYDLHFDGKNPNIWIVGAECSSMPGDYHWYLAEFKLGVERKRTTEQAINLLGRPPPSPPPPPLPSGSDEKNGEVLHRMML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G483700
TK1151 IDTkA03G483700
OH-1004 IDLXL04_009854
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)90.000
Protein coverage (%)TK1151 100.000 / OH-1004 29.567
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G483700
LocationChr03:120999139-121001087 (-)
DescriptionSimilar to SKI2: DExH-box ATP-dependent RNA helicase DExH11
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009854 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000292 RNA fragment catabolic process Biological Process
GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006402 mRNA catabolic process Biological Process
GO:0006417 regulation of translation Biological Process
GO:0006813 potassium ion transport Biological Process
GO:0016441 post-transcriptional gene silencing Biological Process
GO:0030968 endoplasmic reticulum unfolded protein response Biological Process
GO:0035864 response to potassium ion Biological Process
GO:0051607 defense response to virus Biological Process
GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay Biological Process
GO:0070481 nuclear-transcribed mRNA catabolic process, non-stop decay Biological Process
KEGG gene cross-reference
ath:AT3G46960
sce:YLR398C
spo:2538841
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.398
Rank 1 · TkA03G483700 · TK1151
Nucleus0.319
Rank 2 · TkA03G483700 · TK1151
Cell membrane0.151
Rank 3 · TkA03G483700 · TK1151
Mitochondrion0.128
Rank 4 · TkA03G483700 · TK1151
Endoplasmic reticulum0.078
Rank 5 · TkA03G483700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17520DUF5445403-423 aa
PF17520DUF5445503-522 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G483700PF17520DUF54454034230.1213.0
TkA03G483700PF17520DUF54455035220.1213.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser