TkA03G483370 | RubberDandelionOmics

Gene overview

TkA03G483370

Reference: TK1151 Chr: Chr03 Coordinates: 120901845-120904424 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2082 bp · TkA03G483370|TK1151|cDNA

ATAAAGACATTTAAAACGGATGCAAACATTAACAATTGTTGTGGTCTGTGAACCGTTGCTCCCCGGCCCCAACATTTGAAACTATCAGCAACGGCTACTTCTTCATCTTCCTTCTCCGACCTCACTCTCCATTTCTCACTACAATCATCTCTCCATCGTTTACAGGGATAATGAGCAACTACGTTGCCGCATCTGTCTCTGGCTCAATGGCGGATCAGGGTGCTCCTCCTCCTCCTCTGCCTCACCGCCGGCCAAGAGTC...

CDS

Download CDS FASTA

1623 bp · TkA03G483370|TK1151|CDS

ATGAGCAACTACGTTGCCGCATCTGTCTCTGGCTCAATGGCGGATCAGGGTGCTCCTCCTCCTCCTCTGCCTCACCGCCGGCCAAGAGTCAGGGAGGTCAGCTCCAGGTTTATGTCTCCATCACCAGCAGCTTCTTCATCTGCCGGAGATCTCCACTCTATCACCATGAAATCGCCAATTTCCAGATCTAGCCACGTCGGCTCAACTCCGGTGCCTGAAAGATCATCAAAACCCTCACCCTCTCAGAGACGCCTGGTGTT...

Protein

Download Protein FASTA

540 aa · TkA03G483370|TK1151|PROTEIN

MSNYVAASVSGSMADQGAPPPPLPHRRPRVREVSSRFMSPSPAASSSAGDLHSITMKSPISRSSHVGSTPVPERSSKPSPSQRRLVLRNHEHEPLSSSASFSSSHENIPETHRSMDTPFQHAKPETFTIHRKQSAKENGFGAHKSKSTSLRPGKSSRSDTPIASTTDRIVPSRFRLPQRLTSSSVTDAAKLLQSTGLSFSSSNLSSNNDTAIAVSQSFVESQHPPHESEQMQGGSNSCPNSPISSQHTRTWPLPETRSSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G483370`
TK1151 ID	TkA03G483370
OH-1004 ID	LXL04_009933
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G483370

Location Chr03:120901845-120904424 (-)

Description Similar to EDE1: Protein ENDOSPERM DEFECTIVE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44190`	Microtubule-associated protein required for seed development and for microtubule function in the endosperm.	ENDOSPERM DEFECTIVE1 Is a Novel Microtubule-Associated Protein Essential for Seed Development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.061812 Endosperm cellularization defines an important developmental transition for embryo development.2012 · DOI: 10.1242/dev.077057
`At3g60000`	QWRF motif-containing protein 6.	No verified direct reference in this release
`At4g30710`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009960 endosperm development Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0048316 seed development Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005880 nuclear microtubule Cellular Component

KEGG gene cross-reference

ath:AT2G44190

ath:AT3G19570

ath:AT3G60000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · TkA03G483370 · TK1151

Nucleus0.344

Rank 2 · TkA03G483370 · TK1151

Cell membrane0.176

Rank 3 · TkA03G483370 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA03G483370 · TK1151

Golgi apparatus0.033

Rank 5 · TkA03G483370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04484QWRF66-175 aa

PF04484QWRF205-508 aa

PF31247HAUS8357-501 aa

PF27944CEP162_coil_mid375-417 aa

PF08654DASH_Dad2392-422 aa

PF27944CEP162_coil_mid465-487 aa

PF08654DASH_Dad2470-499 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G483370	`PF04484`	QWRF	66	175	7e-61	207.3
TkA03G483370	`PF04484`	QWRF	205	508	7e-61	207.3
TkA03G483370	`PF31247`	HAUS8	357	501	0.0014	19.1
TkA03G483370	`PF27944`	CEP162_coil_mid	375	417	0.023	15.4
TkA03G483370	`PF08654`	DASH_Dad2	392	422	0.24	12.5
TkA03G483370	`PF27944`	CEP162_coil_mid	465	487	0.023	15.4
TkA03G483370	`PF08654`	DASH_Dad2	470	499	0.24	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80588`	Arabidopsis thaliana	sp\|O80588\|EDE1_ARATH Protein ENDOSPERM DEFECTIVE 1	34.000%	Swiss-Prot	Medium
`Q5BPM6`	Arabidopsis thaliana	sp\|Q5BPM6\|QWRF6_ARATH QWRF motif-containing protein 6	34.700%	Swiss-Prot	Medium
`Q9SUH5`	Arabidopsis thaliana	sp\|Q9SUH5\|AUG8_ARATH AUGMIN subunit 8	37.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card