Gene Card
Gene overview
cDNA / CDS / Protein Sequences
366 bp · TkA03G479440|TK1151|cDNA
ATGAAAAATGTAGCTACATCTGCTGTTAAAGCCAGCAGATTATACCACGAATTGAATGCACAAACTGTCAGACACTTGGATAAGCTTCACGAGTATCTTGGAGTGATGTTAGTTGTGAACAATGCATATGCAGATGGATCTAATGCTCTGTTAACAGTCCAGACTCTTCTTTTACAGTTCTCAAATTTAAATTCCAGAATTGAAAAACTTGAAGTAGCTGCCTCCAAGATATTTGGTGGTGACAGGTTTAGAGTTAGGAA...
366 bp · TkA03G479440|TK1151|CDS
ATGAAAAATGTAGCTACATCTGCTGTTAAAGCCAGCAGATTATACCACGAATTGAATGCACAAACTGTCAGACACTTGGATAAGCTTCACGAGTATCTTGGAGTGATGTTAGTTGTGAACAATGCATATGCAGATGGATCTAATGCTCTGTTAACAGTCCAGACTCTTCTTTTACAGTTCTCAAATTTAAATTCCAGAATTGAAAAACTTGAAGTAGCTGCCTCCAAGATATTTGGTGGTGACAGGTTTAGAGTTAGGAA...
Protein
Download Protein FASTA121 aa · TkA03G479440|TK1151|PROTEIN
MKNVATSAVKASRLYHELNAQTVRHLDKLHEYLGVMLVVNNAYADGSNALLTVQTLLLQFSNLNSRIEKLEVAASKIFGGDRFRVRKIDELKETMSVTDEAKNCAVRKYERIKVAYFVFDF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G479440 |
|---|---|
| TK1151 ID | TkA03G479440 |
| OH-1004 ID | LXL04_012188 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 90.300 |
| Protein coverage (%) | TK1151 93.388 / OH-1004 20.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G479440 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:119848867-119849317 (+) | |||||||||
| Description | Similar to SNX2A: Sorting nexin 2A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006623 protein targeting to vacuole Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006896 Golgi to vacuole transport Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0009958 positive gravitropism Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0031623 receptor internalization Biological Process GO:0032502 developmental process Biological Process GO:0034498 early endosome to Golgi transport Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0045324 late endosome to vacuole transport Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G06140 ath:AT5G07120 ath:AT5G58440 hsa:6642 mmu:56440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29283NudE_N6-14 aaPF29283NudE_N50-62 aaPF29283NudE_N71-78 aaPF29283NudE_N106-111 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G479440 | PF29283 | NudE_N | 6 | 14 | 3.4 | 8.1 |
| TkA03G479440 | PF29283 | NudE_N | 50 | 62 | 3.4 | 8.1 |
| TkA03G479440 | PF29283 | NudE_N | 71 | 78 | 3.4 | 8.1 |
| TkA03G479440 | PF29283 | NudE_N | 106 | 111 | 3.4 | 8.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.