TkA03G474420 | RubberDandelionOmics

Gene overview

TkA03G474420

Reference: TK1151 Chr: Chr03 Coordinates: 118636439-118639035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · TkA03G474420|TK1151|cDNA

ATAAGGGGCAACACTCAAAGCAAGTGATAGTACAAGGGGGCACTGTTTAATTATTATCTTTATACTTTAAGGAGATACATGTAATAAAACTTTGCCCTTATTCATCGTCGCTGCGTAAACCCCTTCAAAACCCCTCACGGCGGCCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCATCAAGTTGAGTTTGACTTATAAAAACAAATTGGGGCACCAAACGAACATTTAATTCGAAGATGGCTCGTTTCCGTAATAA...

CDS

Download CDS FASTA

1011 bp · TkA03G474420|TK1151|CDS

ATGGCTCGTTTCCGTAATAAAAAGAAAGTGGGATTTGTGAAACCAACAAGGAAACAACCACAGCAAAATGTGGACCATGTCACAGGTGACAAGATACCAAGAAGCTTTGTATTTTCAAGATTGAAATTACCTGGTGCTCTAAAACAGTTGCAAGCAGACTTGAGAAAAATGATGCTTCCATATACAGCTCTAAATCTAAAGGAAAAGAAGCGCAACAACTTGAAAGATTTCTTGAATGTTGCGGGGCCCATGGGAGTGAC...

Protein

Download Protein FASTA

336 aa · TkA03G474420|TK1151|PROTEIN

MARFRNKKKVGFVKPTRKQPQQNVDHVTGDKIPRSFVFSRLKLPGALKQLQADLRKMMLPYTALNLKEKKRNNLKDFLNVAGPMGVTHFLMLSKTGSSPYLRVARTPQGPTLTFKIQEYSLAVDIANSQLRPRVPKDLFKNSPLIVLSGFGTGEQHLKLTTIMFQNIFPAIDIKTVKLSSCQRIVLLNYNKETKLIDFRHYSIRLQPVGVSRRIRKFVQNHQVPDLRSLQDVSDFVTKAGYGSESEGDDEAATVSLATDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G474420`
TK1151 ID	TkA03G474420
OH-1004 ID	LXL04_009819
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 88.095 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G474420

Location Chr03:118636439-118639035 (+)

Description Similar to PPAN: Peter Pan-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61770`	May play a role in cell growth, differentiation and cell cycle progression.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009819 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0001560 regulation of cell growth by extracellular stimulus Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006412 translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030687 preribosome, large subunit precursor Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0019843 rRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G61770

ddi:DDB_G0285515

hsa:56342

hsa:692312

mmu:235036

pon:100171676

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · TkA03G474420 · TK1151

Cytoplasm0.131

Rank 2 · TkA03G474420 · TK1151

Mitochondrion0.024

Rank 3 · TkA03G474420 · TK1151

Cell membrane0.013

Rank 4 · TkA03G474420 · TK1151

Extracellular0.008

Rank 5 · TkA03G474420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04427Brix46-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G474420	`PF04427`	Brix	46	287	1.3e-44	153.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASU7`	Arabidopsis thaliana	sp\|Q9ASU7\|PPAN_ARATH Peter Pan-like protein	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card