TkA03G469660 | RubberDandelionOmics

Gene overview

TkA03G469660

Reference: TK1151 Chr: Chr03 Coordinates: 117365007-117365891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA03G469660|TK1151|cDNA

ATTGATGATGTAAAGGATTGGATTTTATCAAAACTTCCTCTTGGACCTGCATATTATCCTAAGGATATAACAAGTGAACATCCAGAAAGATTCTTCATAAGTGAAATTGTTAGAGAAAAGATATTTATGCAATTCAGAAATGAAGTTCCTTATGCATGTCAGGTGAATGTAATAAATTACCAAACAAGACCTAATGCAAAAGACTTCATTCAAGTGGAAATAGTTGTTGAGAAAAACACACAAAAAATCATTCTCATTGG...

CDS

Download CDS FASTA

516 bp · TkA03G469660|TK1151|CDS

ATTGATGATGTAAAGGATTGGATTTTATCAAAACTTCCTCTTGGACCTGCATATTATCCTAAGGATATAACAAGTGAACATCCAGAAAGATTCTTCATAAGTGAAATTGTTAGAGAAAAGATATTTATGCAATTCAGAAATGAAGTTCCTTATGCATGTCAGGTGAATGTAATAAATTACCAAACAAGACCTAATGCAAAAGACTTCATTCAAGTGGAAATAGTTGTTGAGAAAAACACACAAAAAATCATTCTCATTGG...

Protein

Download Protein FASTA

171 aa · TkA03G469660|TK1151|PROTEIN

IDDVKDWILSKLPLGPAYYPKDITSEHPERFFISEIVREKIFMQFRNEVPYACQVNVINYQTRPNAKDFIQVEIVVEKNTQKIILIGKDGKALKLLATASRLDIEDFLQKKIFLEVEVKVKENWRQDEELLRYYGYGVKSKLCDFKFKIRHHCCKLVMKIGSFDHYDIGNC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G469660`
TK1151 ID	TkA03G469660
OH-1004 ID	LXL04_013761
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 81.287 / OH-1004 33.413 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G469660

Location Chr03:117365007-117365891 (+)

Description Similar to At5g66470: GTPase ERA-like, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66470`	Nuclear genome-encoded probable GTPase involved in ribosome biogenesis in chloroplasts.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0567300`	Nuclear genome-encoded probable GTPase involved in ribosome biogenesis in chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013761 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000028 ribosomal small subunit assembly Biological Process

GO:0006364 rRNA processing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0019843 rRNA binding Molecular Function

GO:0043024 ribosomal small subunit binding Molecular Function

KEGG gene cross-reference

ath:AT5G66470

dosa:Os05g0567300

gme:Gmet_2315

hmo:HM1_2451

zma:100216562

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA03G469660 · TK1151

Mitochondrion0.253

Rank 2 · TkA03G469660 · TK1151

Nucleus0.235

Rank 3 · TkA03G469660 · TK1151

Peroxisome0.064

Rank 4 · TkA03G469660 · TK1151

Plastid0.039

Rank 5 · TkA03G469660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17789MG445-119 aa

PF07650KH_248-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G469660	`PF17789`	MG4	45	119	0.034	15.0
TkA03G469660	`PF07650`	KH_2	48	125	2.2e-14	53.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ74`	Arabidopsis thaliana	sp\|Q8VZ74\|ERA_ARATH GTPase ERA-like, chloroplastic	85.400%	Swiss-Prot	High
`B9FI63`	Oryza sativa subsp. japonica	sp\|B9FI63\|ERA_ORYSJ GTPase ERA-like, chloroplastic	78.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card