TkA03G466050 | RubberDandelionOmics

Gene overview

TkA03G466050

Reference: TK1151 Chr: Chr03 Coordinates: 116303874-116317261 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2981 bp · TkA03G466050|TK1151|cDNA

TTACACGAGCACCACGTATCAACAACCAATGATCGTTCTTCGCCAAAGACATTGATTCACGATCCTTGCCTTCCTCTATAAAAAACCAGCAGAAGCGGAAACTTGTGTATGTCCGACACATTTCAGGATCTGTTTCTGGAATTCGAATCCTATTTGATTCAATTAATCTGCCTTCAGTCTTTCTTCCACTCAATTCACAATTCTTCAGAAAGAAAAATGTTTGTGCGACACGGACACATCTGGTTTTTGAAGAAAGACGA...

CDS

Download CDS FASTA

1344 bp · TkA03G466050|TK1151|CDS

ATGGGACCCACCGATTTCATCCTCGAGTTCTTCCTCCCCCGCGATTGCAAACGAGATGAAGAACAAAAACAAATCCAAAGGTCCATAATCTCGATGATACAACACGTTTCTTGGAGCTTGCATTTGATAAACGATGAAGAACTTGCAAAAGATGATGAATCCTGGATATCTAATATGGTGAAAGGACGGGAGAGGGACGAAACGGTAATTTTGTCGATGGGGTGTGAGAAGGAAGAGCCGGAAGAAGAAACAAATACCCG...

Protein

Download Protein FASTA

447 aa · TkA03G466050|TK1151|PROTEIN

MGPTDFILEFFLPRDCKRDEEQKQIQRSIISMIQHVSWSLHLINDEELAKDDESWISNMVKGRERDETVILSMGCEKEEPEEETNTRDESWITDMMQAKERGENVVLSMGCHKEEPEEEYNVINEFYNGLGFSQHGNQNYLDWGVGSRSQLLATKRSNIKSRVKAEKNISLQVLQQYFAGSLKDAAKSIGVCPTTLKRICRQYGIMRWPSRKIKKVSHSLKKLQLVIDSVQGAQGMIKLGSFYTNFPELNSPTSPTPTLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G466050`
TK1151 ID	TkA03G466050
OH-1004 ID	LXL04_009712
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 56.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G466050

Location Chr03:116303874-116317261 (+)

Description Similar to NLP1: Protein NLP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35270`	Probable transcription factor.	No verified direct reference in this release
`At2g17150`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At1g20640`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0131100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010167 response to nitrate Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0090548 response to nitrate starvation Biological Process

GO:0097009 energy homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G20640

ath:AT1G76350

ath:AT2G17150

ath:AT4G35270

dosa:Os03g0131100

osa:4331508

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA03G466050 · TK1151

Cytoplasm0.077

Rank 2 · TkA03G466050 · TK1151

Cell membrane0.028

Rank 3 · TkA03G466050 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA03G466050 · TK1151

Plastid0.014

Rank 5 · TkA03G466050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22922GAF_NLP2-40 aa

PF02042RWP-RK162-235 aa

PF00564PB1346-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G466050	`PF22922`	GAF_NLP	2	40	1.2e-08	35.3
TkA03G466050	`PF02042`	RWP-RK	162	235	5.4e-26	91.3
TkA03G466050	`PF00564`	PB1	346	428	1.1e-19	70.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7X9B9`	Arabidopsis thaliana	sp\|Q7X9B9\|NLP2_ARATH Protein NLP2	36.900%	Swiss-Prot	Medium
`Q8H111`	Arabidopsis thaliana	sp\|Q8H111\|NLP1_ARATH Protein NLP1	37.000%	Swiss-Prot	Medium
`Q9SFW8`	Arabidopsis thaliana	sp\|Q9SFW8\|NLP5_ARATH Protein NLP5	37.500%	Swiss-Prot	Medium
`Q9LE38`	Arabidopsis thaliana	sp\|Q9LE38\|NLP4_ARATH Protein NLP4	36.900%	Swiss-Prot	Medium
`Q10S83`	Oryza sativa subsp. japonica	sp\|Q10S83\|NLP1_ORYSJ Protein NLP1	31.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card