RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G463070
Reference: TK1151 Chr: Chr03 Coordinates: 115574919-115578781 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1775 bp · TkA03G463070|TK1151|cDNA

GACGGTGGGGTTAACAGCCCTACTTCTCAGCGGGTGGTTTCCTCGCCGTGGAGTCAGATTGTTCGCCGTGGCGGCGGCGGCGAGTCAGAAGTGATTTCTCCGGTTGTGGTGGTGACGGTCGGTTCTGCTCCGGCATCACCGTCGCGGTCATCGGTTCAGGAGCATGTTGCAAACTCTTCTCCGGATTCGTCTCCGTCTAAGGTGATTCAGGAACCGGTCAGCTCTATGGATGATTCGGGTACGGAAGGTCAGCCTGATGG...

CDS

Download CDS FASTA

996 bp · TkA03G463070|TK1151|CDS

GACGGTGGGGTTAACAGCCCTACTTCTCAGCGGGTGGTTTCCTCGCCGTGGAGTCAGATTGTTCGCCGTGGCGGCGGCGGCGAGTCAGAAGTGATTTCTCCGGTTGTGGTGGTGACGGTCGGTTCTGCTCCGGCATCACCGTCGCGGTCATCGGTTCAGGAGCATGTTGCAAACTCTTCTCCGGATTCGTCTCCGTCTAAGGTGATTCAGGAACCGGTCAGCTCTATGGATGATTCGGGTACGGAAGGTCAGCCTGATGG...

Protein

Download Protein FASTA

331 aa · TkA03G463070|TK1151|PROTEIN

DGGVNSPTSQRVVSSPWSQIVRRGGGGESEVISPVVVVTVGSAPASPSRSSVQEHVANSSPDSSPSKVIQEPVSSMDDSGTEGQPDGSDNTGGSNAAKKPVWNRPSNGVVEVVSPVMGAAWPALGESTKASLKSSSSESLKALSDASLPPALQVTGNSSSPHKHSSNNNVNSTSPPNNVAPTRQRSMKRGGGNSTPNGILPQQPPTRQDSSLERPHNTSRKPTIVADQPSPKDHTHKDSPKGGFGSHSHDNNNHHRGSFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G463070
TK1151 IDTkA03G463070
OH-1004 IDLXL04_013830
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)98.700
Protein coverage (%)TK1151 91.541 / OH-1004 62.090
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G463070
LocationChr03:115574919-115578781 (-)
DescriptionSimilar to LARP1C: La-related protein 1C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013830 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006402 mRNA catabolic process Biological Process
GO:0006413 translational initiation Biological Process
GO:0008283 cell population proliferation Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009749 response to glucose Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010286 heat acclimation Biological Process
GO:0010608 post-transcriptional regulation of gene expression Biological Process
GO:0016239 positive regulation of macroautophagy Biological Process
KEGG gene cross-reference
ath:AT4G35890
ath:AT5G21160
ath:AT5G66100
hsa:23367
hsa:55132
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.718
Rank 1 · TkA03G463070 · TK1151
Nucleus0.254
Rank 2 · TkA03G463070 · TK1151
Cell membrane0.094
Rank 3 · TkA03G463070 · TK1151
Golgi apparatus0.050
Rank 4 · TkA03G463070 · TK1151
Mitochondrion0.036
Rank 5 · TkA03G463070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser