TkA03G459080 | RubberDandelionOmics

Gene overview

TkA03G459080

Reference: TK1151 Chr: Chr03 Coordinates: 114588151-114594809 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1971 bp · TkA03G459080|TK1151|cDNA

ATGATTCACACCTGTGCCATTAATCTCGGTTCCTTCTGGGATAATTCGATCTTTGAAGGTGTTGTGGTCGAGTCTAGTGGTAGATCAGGAGGGTTGTTTTGCCTATGGAACTCGTTTTTGCTCAAGCAGGTGGACATCATTAAGTCGAGATGTTATATTCTGGTTTCTGGAATGTGGAGGGGATGCTCGCAAAAGGTGAATTTCCTTAATGTCTATGCCCCAAATGATCACTCTGCGAGGATATCTCTTTGGACTGAAAT...

CDS

Download CDS FASTA

1971 bp · TkA03G459080|TK1151|CDS

ATGATTCACACCTGTGCCATTAATCTCGGTTCCTTCTGGGATAATTCGATCTTTGAAGGTGTTGTGGTCGAGTCTAGTGGTAGATCAGGAGGGTTGTTTTGCCTATGGAACTCGTTTTTGCTCAAGCAGGTGGACATCATTAAGTCGAGATGTTATATTCTGGTTTCTGGAATGTGGAGGGGATGCTCGCAAAAGGTGAATTTCCTTAATGTCTATGCCCCAAATGATCACTCTGCGAGGATATCTCTTTGGACTGAAAT...

Protein

Download Protein FASTA

656 aa · TkA03G459080|TK1151|PROTEIN

MIHTCAINLGSFWDNSIFEGVVVESSGRSGGLFCLWNSFLLKQVDIIKSRCYILVSGMWRGCSQKVNFLNVYAPNDHSARISLWTEIIDLKNSRDGLWILMGDFNEVRRKEDRFSEWVCTAGMNAFNNFIHDGGLIDFSTGAKRFTRMSDDGKCLSKIDRFLACNGFIDKWSCSVVTVLPRLHSDHNPIILVNESFDFGQILFKFYNSWLHLDGLTEVVLNSWDKNVARYLCPDRRMLGKLKKLKLDIKSWRNITRSQEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G459080`
TK1151 ID	TkA03G459080
OH-1004 ID	LXL04_010712
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.700
Protein coverage (%)	TK1151 53.049 / OH-1004 43.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G459080

Location Chr03:114588151-114594809 (-)

Description Similar to Transposon TX1 uncharacterized 149 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010712 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA03G459080 · TK1151

Nucleus0.318

Rank 2 · TkA03G459080 · TK1151

Cell membrane0.116

Rank 3 · TkA03G459080 · TK1151

Plastid0.041

Rank 4 · TkA03G459080 · TK1151

Lysosome / Vacuole0.038

Rank 5 · TkA03G459080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos52-180 aa

PF14529Exo_endo_phos_267-190 aa

PF18363PI_PP_I99-117 aa

PF18363PI_PP_I404-448 aa

PF18363PI_PP_I560-611 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G459080	`PF03372`	Exo_endo_phos	52	180	0.00062	20.3
TkA03G459080	`PF14529`	Exo_endo_phos_2	67	190	0.00021	21.9
TkA03G459080	`PF18363`	PI_PP_I	99	117	0.21	12.5
TkA03G459080	`PF18363`	PI_PP_I	404	448	0.21	12.5
TkA03G459080	`PF18363`	PI_PP_I	560	611	0.21	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	sp\|P0C2F6\|RNHX1_ARATH Putative ribonuclease H protein At1g65750	33.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card