TkA03G458160 | RubberDandelionOmics

Gene overview

TkA03G458160

Reference: TK1151 Chr: Chr03 Coordinates: 114386994-114387806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

813 bp · TkA03G458160|TK1151|cDNA

ATGGTGAGGGCGGTGGTGTACTGCAAAGCCGACGCGGCGTCGCTGTGTTTGAAGTGCGACGGCTGTGTGCACTCCGCCAACGCCATATCCAGCCGCCATCTCCGCTCTCTTATCTGCGACAGATGCGCCGCCCAGGCCGCGGTGGTCCATTGTCTCGACGAGAAGCTCTGCTTTTGCCAGGGCTGCGACCACCCCTGCTTCTTGGCGGAGCACCGCCGCGCCGCCTTGAGATTCTACAGTGGCTGCCCTTCTATCACAGA...

CDS

Download CDS FASTA

813 bp · TkA03G458160|TK1151|CDS

ATGGTGAGGGCGGTGGTGTACTGCAAAGCCGACGCGGCGTCGCTGTGTTTGAAGTGCGACGGCTGTGTGCACTCCGCCAACGCCATATCCAGCCGCCATCTCCGCTCTCTTATCTGCGACAGATGCGCCGCCCAGGCCGCGGTGGTCCATTGTCTCGACGAGAAGCTCTGCTTTTGCCAGGGCTGCGACCACCCCTGCTTCTTGGCGGAGCACCGCCGCGCCGCCTTGAGATTCTACAGTGGCTGCCCTTCTATCACAGA...

Protein

Download Protein FASTA

270 aa · TkA03G458160|TK1151|PROTEIN

MVRAVVYCKADAASLCLKCDGCVHSANAISSRHLRSLICDRCAAQAAVVHCLDEKLCFCQGCDHPCFLAEHRRAALRFYSGCPSITEFSKIWPFVLEGTNSQQDLAVVVNENETAGRSPFLKFGQWAVPVPVPVPPQPPPPPPPPLPPKYALTAYSRDLMPFIPEESTLQKVTVFLPPPRALFFANSVDLISQDCGDTAEDIGIQECEDLCDSVDIDGMPLSFESGYDMFENLQNQSRYHCNDGGMTGLLNASVTESDST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G458160`
TK1151 ID	TkA03G458160
OH-1004 ID	LXL04_020221
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.700
Protein coverage (%)	TK1151 30.000 / OH-1004 19.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G458160

Location Chr03:114386994-114387806 (-)

Description Similar to COL9: Zinc finger protein CONSTANS-LIKE 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48250`	Zinc finger protein CONSTANS-LIKE 10.	No verified direct reference in this release
`At1g68190`	Putative zinc finger protein At1g68190.	No verified direct reference in this release
`At3g07650`	Zinc finger protein CONSTANS-LIKE 9.	No verified direct reference in this release
`At3g21880`	Zinc finger protein CONSTANS-LIKE 12.	No verified direct reference in this release
`At4g15248`	Developmental regulator acting by forming heterodimeric complexes, that sequester CO and CO-like (COL) proteins into non-functional complexes.	MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005959

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G68190

ath:AT3G07650

ath:AT3G21880

ath:AT4G15250

ath:AT5G48250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.601

Rank 1 · TkA03G458160 · TK1151

Cytoplasm0.402

Rank 2 · TkA03G458160 · TK1151

Cell membrane0.067

Rank 3 · TkA03G458160 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA03G458160 · TK1151

Golgi apparatus0.044

Rank 5 · TkA03G458160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00643zf-B_box4-25 aa

PF22586ANCHR-like_BBOX7-20 aa

PF00643zf-B_box37-72 aa

PF22586ANCHR-like_BBOX39-63 aa

PF05308Mito_fiss_reg130-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G458160	`PF00643`	zf-B_box	4	25	1.5	9.8
TkA03G458160	`PF22586`	ANCHR-like_BBOX	7	20	4.3	8.2
TkA03G458160	`PF00643`	zf-B_box	37	72	1.5	9.8
TkA03G458160	`PF22586`	ANCHR-like_BBOX	39	63	4.3	8.2
TkA03G458160	`PF05308`	Mito_fiss_reg	130	148	7.8	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUA9`	Arabidopsis thaliana	sp\|Q9LUA9\|COL10_ARATH Zinc finger protein CONSTANS-LIKE 10	37.300%	Swiss-Prot	Low
`Q9C9F4`	Arabidopsis thaliana	sp\|Q9C9F4\|COLX_ARATH Putative zinc finger protein At1g68190	38.900%	Swiss-Prot	Low
`Q9SSE5`	Arabidopsis thaliana	sp\|Q9SSE5\|COL9_ARATH Zinc finger protein CONSTANS-LIKE 9	33.900%	Swiss-Prot	Low
`Q9LJ44`	Arabidopsis thaliana	sp\|Q9LJ44\|COL12_ARATH Zinc finger protein CONSTANS-LIKE 12	35.700%	Swiss-Prot	Low
`Q1G3I2`	Arabidopsis thaliana	sp\|Q1G3I2\|MIP1A_ARATH B-box domain protein 30	62.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card