TkA03G458140 | RubberDandelionOmics

Gene overview

TkA03G458140

Reference: TK1151 Chr: Chr03 Coordinates: 114384392-114385132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

741 bp · TkA03G458140|TK1151|cDNA

ATGGGCTTCTCAAACCGGGCTTTTTCCCTCACTCTCTCGGCCCTAATCTCCTCTCTCTTCATCCAAATCGCCATTTCTATTGATCCTCTATACACCATTTGTTCCACCTCCCAACTAAACTTCTCTTCCAACTCACCTTATCAAAGCAACCTCAACAACCTCTTAGGTGATCTCTACTTCAAAACCCCACCAACCGGGTTCGGGCTAGCATCATCTGGCCAGTATCAAGACCGGGCTTACGGCCTCTCCCTCTGCCGGGG...

CDS

Download CDS FASTA

741 bp · TkA03G458140|TK1151|CDS

ATGGGCTTCTCAAACCGGGCTTTTTCCCTCACTCTCTCGGCCCTAATCTCCTCTCTCTTCATCCAAATCGCCATTTCTATTGATCCTCTATACACCATTTGTTCCACCTCCCAACTAAACTTCTCTTCCAACTCACCTTATCAAAGCAACCTCAACAACCTCTTAGGTGATCTCTACTTCAAAACCCCACCAACCGGGTTCGGGCTAGCATCATCTGGCCAGTATCAAGACCGGGCTTACGGCCTCTCCCTCTGCCGGGG...

Protein

Download Protein FASTA

246 aa · TkA03G458140|TK1151|PROTEIN

MGFSNRAFSLTLSALISSLFIQIAISIDPLYTICSTSQLNFSSNSPYQSNLNNLLGDLYFKTPPTGFGLASSGQYQDRAYGLSLCRGDVSAKDCTACVVEASSTITKRCPNNRGAIVWYDNCYLKYSDNNFFGKIDTQNRFYMWNTRNFSSNVDEFNQKTKELLRKLSENASETSRMHANGEVEMRDDEKIYGMVECSRDISRDDCKKCVDDSINLLPLCCEGKKGGRVVGGSCSIRYEIYSFFNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G458140`
TK1151 ID	TkA03G458140
OH-1004 ID	LXL04_016913
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.500
Protein coverage (%)	TK1151 97.561 / OH-1004 98.367 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G458140

Location Chr03:114384392-114385132 (-)

Description Similar to CRRSP38: Cysteine-rich repeat secretory protein 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22060`	Cysteine-rich repeat secretory protein 38.	No verified direct reference in this release
`At3g58310`	Putative cysteine-rich repeat secretory protein 61.	No verified direct reference in this release
`At3g21937`	Putative cysteine-rich repeat secretory protein 21.	No verified direct reference in this release
`At3g21940`	Putative cysteine-rich repeat secretory protein 22.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016913 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT3G21960

ath:AT3G22060

ath:AT3G58310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.586

Rank 1 · TkA03G458140 · TK1151

Extracellular0.228

Rank 2 · TkA03G458140 · TK1151

Endoplasmic reticulum0.076

Rank 3 · TkA03G458140 · TK1151

Cytoplasm0.072

Rank 4 · TkA03G458140 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA03G458140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung34-128 aa

PF13774Longin100-115 aa

PF01657Stress-antifung147-240 aa

PF13774Longin148-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G458140	`PF01657`	Stress-antifung	34	128	1.8e-41	141.5
TkA03G458140	`PF13774`	Longin	100	115	0.07	13.9
TkA03G458140	`PF01657`	Stress-antifung	147	240	1.8e-41	141.5
TkA03G458140	`PF13774`	Longin	148	203	0.07	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRJ9`	Arabidopsis thaliana	sp\|Q9LRJ9\|CRR38_ARATH Cysteine-rich repeat secretory protein 38	48.600%	Swiss-Prot	Medium
`Q9M2I5`	Arabidopsis thaliana	sp\|Q9M2I5\|CRR61_ARATH Putative cysteine-rich repeat secretory protein 61	43.800%	Swiss-Prot	Medium
`Q9LRL8`	Arabidopsis thaliana	sp\|Q9LRL8\|CRR21_ARATH Putative cysteine-rich repeat secretory protein 21	38.200%	Swiss-Prot	Medium
`Q9LRL7`	Arabidopsis thaliana	sp\|Q9LRL7\|CRR22_ARATH Putative cysteine-rich repeat secretory protein 22	36.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card