TkA03G457860 | RubberDandelionOmics

Gene overview

TkA03G457860

Reference: TK1151 Chr: Chr03 Coordinates: 114287769-114289353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · TkA03G457860|TK1151|cDNA

ATGGTACTCCATGGTGTTCCTTTTTCTTCGTCGGAGATTGTTAGGACCACTTCATCGCTTTTGTTCTCCGTCATGCTGATCTCCCCTGTTTTTGAGGTAACAGTTAATGCTTCGAGGATTCCCTCGAAACTCACTTACGCACTTCACAGCAAAATCGATTTCAAGTCCAAAAACAATACGAAAGGATGCGTCACACTCACGCACAAGCACAGATCATACAAGAACAATGAAGTCAACAATGGTGGTGCACCGACGATGGT...

CDS

Download CDS FASTA

840 bp · TkA03G457860|TK1151|CDS

ATGGTACTCCATGGTGTTCCTTTTTCTTCGTCGGAGATTGTTAGGACCACTTCATCGCTTTTGTTCTCCGTCATGCTGATCTCCCCTGTTTTTGAGGTAACAGTTAATGCTTCGAGGATTCCCTCGAAACTCACTTACGCACTTCACAGCAAAATCGATTTCAAGTCCAAAAACAATACGAAAGGATGCGTCACACTCACGCACAAGCACAGATCATACAAGAACAATGAAGTCAACAATGGTGGTGCACCGACGATGGT...

Protein

Download Protein FASTA

279 aa · TkA03G457860|TK1151|PROTEIN

MVLHGVPFSSSEIVRTTSSLLFSVMLISPVFEVTVNASRIPSKLTYALHSKIDFKSKNNTKGCVTLTHKHRSYKNNEVNNGGAPTMVRRWSGSGPAVGAQLVVRLWSDSGPAVVQRWSGGGCTAGGPAVVRWCPGGGPVVGKQPVVRRWSGSGPAVVRWWSDGGPVVGAQPVVRRWSGGGPAVVRWWVHSRWSDGGPAVVQRWSGGGPAVVRWWVHSRWSDGGPAVVQRWSGGGPAVGAQPVVRRWSGGGCTAGGPTMVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G457860`
TK1151 ID	TkA03G457860
OH-1004 ID	LXL04_038429
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	60.000
Protein coverage (%)	TK1151 43.369 / OH-1004 31.049 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G457860`
Location	Chr03:114287769-114289353 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038429` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.308

Rank 1 · TkA03G457860 · TK1151

Cell membrane0.256

Rank 2 · TkA03G457860 · TK1151

Nucleus0.245

Rank 3 · TkA03G457860 · TK1151

Endoplasmic reticulum0.116

Rank 4 · TkA03G457860 · TK1151

Golgi apparatus0.112

Rank 5 · TkA03G457860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03752ALF91-97 aa

PF03752ALF101-113 aa

PF03752ALF124-129 aa

PF03752ALF155-167 aa

PF03752ALF179-192 aa

PF03752ALF206-219 aa

PF03752ALF219-226 aa

PF03752ALF225-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G457860	`PF03752`	ALF	91	97	0.79	10.4
TkA03G457860	`PF03752`	ALF	101	113	0.79	10.4
TkA03G457860	`PF03752`	ALF	124	129	0.79	10.4
TkA03G457860	`PF03752`	ALF	155	167	0.79	10.4
TkA03G457860	`PF03752`	ALF	179	192	0.79	10.4
TkA03G457860	`PF03752`	ALF	206	219	0.79	10.4
TkA03G457860	`PF03752`	ALF	219	226	0.79	10.4
TkA03G457860	`PF03752`	ALF	225	237	0.79	10.4
TkA03G457860	`PF03752`	ALF	253	264	0.79	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card