TkA03G456100 | RubberDandelionOmics

Gene overview

TkA03G456100

Reference: TK1151 Chr: Chr03 Coordinates: 113868668-113875689 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5164 bp · TkA03G456100|TK1151|cDNA

AGTAAATGTTCTATCTTATAAAATTACACAAGTTTTTAGAAATTAATGTAAAAAAATATAAAAATGTGTAGTTGTGTACATTTTATTTTACAACACTGTGCCCTTGAATTTCTGATTGATTTCTACGAACCAAAAAAACAGAAAGTCTAACCTCATTCGATGCAAAGCGAAGCGCACGAGTTCTCTTTCGTTATTCTCGTTTGGATCTTTTTTTTCTTCTCGATTTCTGTATGAATTCGCCTTTTCATCATAAATTTTCT...

CDS

Download CDS FASTA

4647 bp · TkA03G456100|TK1151|CDS

ATGAACCTTAACCCTCTCATAAACACCTTAAAGCAGGTTCATTATGAGACAATGGACTCACCTGGTCATGGATCAAGAAACACATCTGTGGTTATTCTTACACTTGATACAAGTGAGGTATACATAATCATCAGCTTATCTTCTAGAAGCGACACTCAAGTCATTTACATCGATCCAACAACCGGATCTCTCCACCATGACCATAAGCCAGGTCACGATGTTTTCACCTCCCAAGAAGAAGCCCTAACCTCCATCACAAA...

Protein

Download Protein FASTA

1548 aa · TkA03G456100|TK1151|PROTEIN

MNLNPLINTLKQVHYETMDSPGHGSRNTSVVILTLDTSEVYIIISLSSRSDTQVIYIDPTTGSLHHDHKPGHDVFTSQEEALTSITNGSKFIIKSTIHAKAILGYAVLGTTSLLLVATKLTASIPFLPGGGCIYTITESKWIKTTLQNPQPQGKGEVKNIQELTELEIDGKHYFCESRDITRPFPSRVSVKSPDEEYVWNGWFSVSFKRIGLDQHCVILLQGFVEYRTFGTLGQQEGIVALIARRSRLHPGTRYLARGLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G456100`
TK1151 ID	TkA03G456100
OH-1004 ID	LXL04_033394
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.400
Protein coverage (%)	TK1151 98.514 / OH-1004 96.185 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G456100

Location Chr03:113868668-113875689 (+)

Description Similar to SAC9: Probable phosphoinositide phosphatase SAC9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59770`	Probable phosphoinositide phosphatase that could be involved in stress signaling.	Mutations in the Arabidopsis phosphoinositide phosphatase gene SAC9 lead to overaccumulation of PtdIns(4,5)P2 and constitutive expression of the stress-response pathway.2005 · DOI: 10.1104/pp.105.061317
`At1g17340`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033394 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0048015 phosphatidylinositol-mediated signaling Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G17340

ath:AT3G43220

ath:AT3G59770

ath:AT5G20840

spo:3361401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · TkA03G456100 · TK1151

Nucleus0.285

Rank 2 · TkA03G456100 · TK1151

Golgi apparatus0.112

Rank 3 · TkA03G456100 · TK1151

Cell membrane0.098

Rank 4 · TkA03G456100 · TK1151

Lysosome / Vacuole0.083

Rank 5 · TkA03G456100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383Syja_N101-399 aa

PF24790SAC9_GBDL_1st631-815 aa

PF24789SAC9_GBDL_2nd660-714 aa

PF24791SAC9_C8D1013-1066 aa

PF24789SAC9_GBDL_2nd1152-1349 aa

PF24790SAC9_GBDL_1st1161-1226 aa

PF24765SAC9_C1277-1295 aa

PF24765SAC9_C1380-1548 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G456100	`PF02383`	Syja_N	101	399	4.9e-43	148.3
TkA03G456100	`PF24790`	SAC9_GBDL_1st	631	815	2e-87	292.2
TkA03G456100	`PF24789`	SAC9_GBDL_2nd	660	714	1.3e-94	316.3
TkA03G456100	`PF24791`	SAC9_C8D	1013	1066	0.00024	22.2
TkA03G456100	`PF24789`	SAC9_GBDL_2nd	1152	1349	1.3e-94	316.3
TkA03G456100	`PF24790`	SAC9_GBDL_1st	1161	1226	2e-87	292.2
TkA03G456100	`PF24765`	SAC9_C	1277	1295	1.8e-68	230.6
TkA03G456100	`PF24765`	SAC9_C	1380	1548	1.8e-68	230.6
TkA03G456100	`PF24790`	SAC9_GBDL_1st	1451	1490	2e-87	292.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XZU0`	Arabidopsis thaliana	sp\|Q7XZU0\|SAC9_ARATH Probable phosphoinositide phosphatase SAC9	55.600%	Swiss-Prot	High
`Q8RW97`	Arabidopsis thaliana	sp\|Q8RW97\|SAC5_ARATH Phosphoinositide phosphatase SAC5	25.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card