TkA03G452150 | RubberDandelionOmics

Gene overview

TkA03G452150

Reference: TK1151 Chr: Chr03 Coordinates: 112822375-112822890 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA03G452150|TK1151|cDNA

AAGTATGACTTTACTGCAAAAGGCGAGACAGTAAAAAACTATACTTTTTACAACTACACATCTGGTTACATTCATCAGTGCCATCTTGAAAACCTTGAGTATGACACCAAGTACTATTATGAGATTGGAGAAGGTGATTCTGCTCGATCATTTTGGTTTCAAACACCTCCAAAGATCGATCCAAATGCTTCTTACAAATTCGGAATCATTGGCGACCTGGGTCAAACTTACAACTCTCTATCCACTCTTGAACATTACAT...

CDS

Download CDS FASTA

357 bp · TkA03G452150|TK1151|CDS

AAGTATGACTTTACTGCAAAAGGCGAGACAGTAAAAAACTATACTTTTTACAACTACACATCTGGTTACATTCATCAGTGCCATCTTGAAAACCTTGAGTATGACACCAAGTACTATTATGAGATTGGAGAAGGTGATTCTGCTCGATCATTTTGGTTTCAAACACCTCCAAAGATCGATCCAAATGCTTCTTACAAATTCGGAATCATTGGCGACCTGGGTCAAACTTACAACTCTCTATCCACTCTTGAACATTACAT...

Protein

Download Protein FASTA

119 aa · TkA03G452150|TK1151|PROTEIN

KYDFTAKGETVKNYTFYNYTSGYIHQCHLENLEYDTKYYYEIGEGDSARSFWFQTPPKIDPNASYKFGIIGDLGQTYNSLSTLEHYIESGAQIVLHVGDLSYADRYKYHDMGVRWDSYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G452150`
TK1151 ID	TkA03G452150
OH-1004 ID	LXL04_002739
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 25.758 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G452150

Location Chr03:112822375-112822890 (-)

Description Similar to PAP26: Bifunctional purple acid phosphatase 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g34850`	Metallo-phosphoesterase involved in phosphate metabolism.	Biochemical and molecular characterization of AtPAP26, a vacuolar purple acid phosphatase up-regulated in phosphate-deprived Arabidopsis suspension cells and seedlings.2006 · DOI: 10.1104/pp.106.087171
`At2g27190`	Fe(3+)-Zn(2+) purple acid phosphatase 12.	No verified direct reference in this release
`At2g16430`	Purple acid phosphatase 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002739 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0051174 regulation of phosphorus metabolic process Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005775 vacuolar lumen Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G27190

ath:AT5G34850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.490

Rank 1 · TkA03G452150 · TK1151

Lysosome / Vacuole0.290

Rank 2 · TkA03G452150 · TK1151

Cytoplasm0.140

Rank 3 · TkA03G452150 · TK1151

Endoplasmic reticulum0.077

Rank 4 · TkA03G452150 · TK1151

Cell membrane0.051

Rank 5 · TkA03G452150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656Pur_ac_phosph_N2-54 aa

PF10903DUF269126-30 aa

PF10903DUF269175-106 aa

PF16656Pur_ac_phosph_N88-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G452150	`PF16656`	Pur_ac_phosph_N	2	54	1.1e-09	39.5
TkA03G452150	`PF10903`	DUF2691	26	30	0.032	14.7
TkA03G452150	`PF10903`	DUF2691	75	106	0.032	14.7
TkA03G452150	`PF16656`	Pur_ac_phosph_N	88	109	1.1e-09	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Y3`	Arabidopsis thaliana	sp\|Q949Y3\|PPA26_ARATH Bifunctional purple acid phosphatase 26	69.700%	Swiss-Prot	High
`Q38924`	Arabidopsis thaliana	sp\|Q38924\|PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12	62.500%	Swiss-Prot	High
`Q9SIV9`	Arabidopsis thaliana	sp\|Q9SIV9\|PPA10_ARATH Purple acid phosphatase 10	58.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card