Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2496 bp · TkA03G452090|TK1151|cDNA
ATAAACCCTCTTTCAAACCCCTAGGGTTTCCCCGACAAGAGATCGTTAATTCAAGCTTCAAGCTAACTCCAATGGCGACGACGAAGTCCGTCGATGCGTCACTATGGTGGGATCCCTTTACCGACCGACTTACTTACAGAACTCGAAAACTATCTCCATCTCTCGAACTCCCAATTTCTCTGGCGAAGAAATTGAAAGAAAACCACTCATGGTTATTGGACTCTGTCTCTCTATTCAAGCCACCCAATCAGAAATCGAGA...
879 bp · TkA03G452090|TK1151|CDS
ATGTCTGTTCCTGGACTTGAAGGACTGCAGATACCTAGTAACACACGAGGTCATGTTTTGAAATTCATAAATGACAACACTGCCCTTGTACGGTGGGAGTACACACAATCTGGAGTGATGGTGCTTCTGTTGCGTGTGGCACAAGAGATGTATCCGGATGGATCTGAGGAAGTTCTTGCTACCCTTAGTTTGTTTAGTCGACTAGTCTCTTTTAACAAGGATGTGTGTTATTCTCTGATGAACATTGGGGATTCATTCCA...
Protein
Download Protein FASTA292 aa · TkA03G452090|TK1151|PROTEIN
MSVPGLEGLQIPSNTRGHVLKFINDNTALVRWEYTQSGVMVLLLRVAQEMYPDGSEEVLATLSLFSRLVSFNKDVCYSLMNIGDSFHDKDITGFNVAEIICTLIKNLSPKCSGALMMSMGVNILAMMLNCCPSVVIPTVLKTNIFDVSLKMNPFNNGSDGLSSGSWLLSGRLAKLLLIDCEHNDSSCLLAVSGMLIFSSVFFYIDNNFFFLNFNSVVFHFSVLEFTVQLLEKGEENDFLFALVIFCIQYVLVNHEYWKYK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G452090 |
|---|---|
| TK1151 ID | TkA03G452090 |
| OH-1004 ID | LXL04_009628 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 78.300 |
| Protein coverage (%) | TK1151 98.630 / OH-1004 14.301Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G452090 |
|---|---|
| Location | Chr03:112808964-112813817 (-) |
| Description | Similar to NUP188: Nucleoporin NUP188 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006405 RNA export from nucleus Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0051028 mRNA transport Biological Process GO:0005635 nuclear envelope Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0044611 nuclear pore inner ring Cellular Component GO:0017056 structural constituent of nuclear pore Molecular Function |
| KEGG gene cross-reference | hsa:23511 mmu:227699 xtr:100135081 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.