TkA03G450420 | RubberDandelionOmics

Gene overview

TkA03G450420

Reference: TK1151 Chr: Chr03 Coordinates: 112407307-112408956 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1446 bp · TkA03G450420|TK1151|cDNA

ATGCTACCGGTACCACCGCCACCGCCACCAATTCCGCCACCGCTACCATTGTTGCAGAAGCCATCACCACCAGCTCCACCACCACCACCACCTCCAGAAATGAAGCCTTTCCATTGGGATAAAGTGAACACCGACGCAGATCATTCCGTCGTGTGGAATGAAATCGTCGACGGATCTTTGCGATTTGATGACGAACTTATTGAAACGTTATTCGGATATAATGCAACAAAGAAAAACTCCACCGAATCAAAACACATATC...

CDS

Download CDS FASTA

1446 bp · TkA03G450420|TK1151|CDS

ATGCTACCGGTACCACCGCCACCGCCACCAATTCCGCCACCGCTACCATTGTTGCAGAAGCCATCACCACCAGCTCCACCACCACCACCACCTCCAGAAATGAAGCCTTTCCATTGGGATAAAGTGAACACCGACGCAGATCATTCCGTCGTGTGGAATGAAATCGTCGACGGATCTTTGCGATTTGATGACGAACTTATTGAAACGTTATTCGGATATAATGCAACAAAGAAAAACTCCACCGAATCAAAACACATATC...

Protein

Download Protein FASTA

481 aa · TkA03G450420|TK1151|PROTEIN

MLPVPPPPPPIPPPLPLLQKPSPPAPPPPPPPEMKPFHWDKVNTDADHSVVWNEIVDGSLRFDDELIETLFGYNATKKNSTESKHISPKFGTANAISSQISLLDPRKSQNTAIVLKSLATSRKEILDAVSEGRGLTFDVLEKLTKISPTEEEALKILQFNGNPSKLSDAESFLYHILKAIPTAFTRINAMLFRSNYDPEILHLKESLQTLELGCKELRAPGIFLKLLEAILKAGNRMNAGTARGNAKGFNLSALKKLSYV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G450420`
TK1151 ID	TkA03G450420
OH-1004 ID	LXL04_009600
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 93.347 / OH-1004 67.103 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G450420

Location Chr03:112407307-112408956 (-)

Description Similar to FH8: Formin-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70140`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g24150`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At1g59910`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release
`At5g54650`	Might be involved in the organization and polarity of the actin cytoskeleton.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0739100`	Formin-like protein 16.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0009960 endosperm development Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030041 actin filament polymerization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24150

ath:AT1G59910

ath:AT1G70140

ath:AT5G54650

dosa:Os02g0739100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.632

Rank 1 · TkA03G450420 · TK1151

Nucleus0.273

Rank 2 · TkA03G450420 · TK1151

Cell membrane0.224

Rank 3 · TkA03G450420 · TK1151

Golgi apparatus0.044

Rank 4 · TkA03G450420 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA03G450420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181FH227-425 aa

PF30527DnaJ_cyano_C62-81 aa

PF30527DnaJ_cyano_C150-205 aa

PF30527DnaJ_cyano_C365-382 aa

PF17190RecG_N368-399 aa

PF17190RecG_N418-466 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G450420	`PF02181`	FH2	27	425	1.8e-90	304.5
TkA03G450420	`PF30527`	DnaJ_cyano_C	62	81	0.055	14.0
TkA03G450420	`PF30527`	DnaJ_cyano_C	150	205	0.055	14.0
TkA03G450420	`PF30527`	DnaJ_cyano_C	365	382	0.055	14.0
TkA03G450420	`PF17190`	RecG_N	368	399	0.11	13.9
TkA03G450420	`PF17190`	RecG_N	418	466	0.11	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04532`	Arabidopsis thaliana	sp\|O04532\|FH8_ARATH Formin-like protein 8	48.900%	Swiss-Prot	Medium
`O48682`	Arabidopsis thaliana	sp\|O48682\|FH4_ARATH Formin-like protein 4	49.000%	Swiss-Prot	Medium
`Q9XIE0`	Arabidopsis thaliana	sp\|Q9XIE0\|FH7_ARATH Formin-like protein 7	49.000%	Swiss-Prot	Medium
`Q94B77`	Arabidopsis thaliana	sp\|Q94B77\|FH5_ARATH Formin-like protein 5	38.100%	Swiss-Prot	Medium
`A3AB67`	Oryza sativa subsp. japonica	sp\|A3AB67\|FH16_ORYSJ Formin-like protein 16	45.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card