TkA03G440400 | RubberDandelionOmics

Gene overview

TkA03G440400

Reference: TK1151 Chr: Chr03 Coordinates: 109729357-109730452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · TkA03G440400|TK1151|cDNA

TCCACAAGTCGGCCATTGACGGCTGACCGATCGCTGCTTATTGTTGTTGAAAGCCCATCTACGTCTAAAGTCTCCTTCCTAGCTCCAAAATCTTCTACACCAGAGAAAATGGCTTCCGATGAAACCAAGAACCCTGCACTGAATCCGGACACGGATTCTGCGGGCAAATCGGGGCACCAGTTGGCCCAATTCGGAGCTGGATGCTTCTGGGGTGTTGAGCTGGCCTTCCAGCGTCTCGAAGGAGTCGTGAAAACGGAAGT...

CDS

Download CDS FASTA

684 bp · TkA03G440400|TK1151|CDS

TCCACAAGTCGGCCATTGACGGCTGACCGATCGCTGCTTATTGTTGTTGAAAGCCCATCTACGTCTAAAGTCTCCTTCCTAGCTCCAAAATCTTCTACACCAGAGAAAATGGCTTCCGATGAAACCAAGAACCCTGCACTGAATCCGGACACGGATTCTGCGGGCAAATCGGGGCACCAGTTGGCCCAATTCGGAGCTGGATGCTTCTGGGGTGTTGAGCTGGCCTTCCAGCGTCTCGAAGGAGTCGTGAAAACGGAAGT...

Protein

Download Protein FASTA

227 aa · TkA03G440400|TK1151|PROTEIN

STSRPLTADRSLLIVVESPSTSKVSFLAPKSSTPEKMASDETKNPALNPDTDSAGKSGHQLAQFGAGCFWGVELAFQRLEGVVKTEVGYSQGHVHNPNYRLVCTGTTNHSEVVRVEFDPSVCPYTNLLSLFWSRHDPTTLNRQGGDAGTQYRSGIYYYNEEQARLAQESLEEKQKSLKSKIVTEILPAKTFYRAEEYHQQQYLEKGAQSGSKQSARKGCNDPIRCYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G440400`
TK1151 ID	TkA03G440400
OH-1004 ID	LXL04_021760
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	59.000
Protein coverage (%)	TK1151 98.238 / OH-1004 86.486 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G440400

Location Chr03:109729357-109730452 (+)

Description Similar to Peptide methionine sulfoxide reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25130`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	Differential regulation of plastidial and cytosolic isoforms of peptide methionine sulfoxide reductase in Arabidopsis.2000 · DOI: 10.1104/pp.123.1.255 A peptide methionine sulfoxide reductase highly expressed in photosynthetic tissue in Arabidopsis thaliana can protect the chaperone-like activity of a chloroplast-localized small heat shock protein.2002 · DOI: 10.1046/j.1365-313x.2002.029005545.x
`At5g61640`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0482000`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008113 peptide-methionine (S)-S-oxide reductase activity Molecular Function

GO:0033744 L-methionine (S)-S-oxide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G25130

ath:AT5G07470

ath:AT5G61640

bna:106346565

bna:106442570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.627

Rank 1 · TkA03G440400 · TK1151

Nucleus0.396

Rank 2 · TkA03G440400 · TK1151

Mitochondrion0.156

Rank 3 · TkA03G440400 · TK1151

Peroxisome0.060

Rank 4 · TkA03G440400 · TK1151

Cell membrane0.053

Rank 5 · TkA03G440400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01625PMSR62-211 aa

PF04857CAF1140-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G440400	`PF01625`	PMSR	62	211	6.6e-60	202.8
TkA03G440400	`PF04857`	CAF1	140	205	0.0047	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54150`	Arabidopsis thaliana	sp\|P54150\|MSRA4_ARATH Peptide methionine sulfoxide reductase A4, chloroplastic	65.300%	Swiss-Prot	High
`Q9FKF7`	Arabidopsis thaliana	sp\|Q9FKF7\|MSRA1_ARATH Peptide methionine sulfoxide reductase A1	68.200%	Swiss-Prot	High
`Q7XUP7`	Oryza sativa subsp. japonica	sp\|Q7XUP7\|MSR21_ORYSJ Peptide methionine sulfoxide reductase A2-1	66.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card