TkA03G440350 | RubberDandelionOmics

Gene overview

TkA03G440350

Reference: TK1151 Chr: Chr03 Coordinates: 109703168-109709729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · TkA03G440350|TK1151|cDNA

ATGGTCGACCGCATTCTGATAAGATATCTCCGTGACGACATCCCAATCGAAAGTTTTGACTTCAAGATCGATATTGAGAACCAGGAGTTGGCTTCTCATGCTATAAAATGGATTCGCCCTGTGGTAATCAAAACTTGTCTTACAAAGCTTTTCCTCGAAATCATGGTTACCAATGACTCGTTTATGTTGCCAGATGAGATACTCTTTAGTAAAAATCTAAATATAGTAAGAATATATTGTACCTCAAATGTCCATTTCAT...

CDS

Download CDS FASTA

1389 bp · TkA03G440350|TK1151|CDS

ATGGTCGACCGCATTCTGATAAGATATCTCCGTGACGACATCCCAATCGAAAGTTTTGACTTCAAGATCGATATTGAGAACCAGGAGTTGGCTTCTCATGCTATAAAATGGATTCGCCCTGTGGTAATCAAAACTTGTCTTACAAAGCTTTTCCTCGAAATCATGGTTACCAATGACTCGTTTATGTTGCCAGATGAGATACTCTTTAGTAAAAATCTAAATATAGTAAGAATATATTGTACCTCAAATGTCCATTTCAT...

Protein

Download Protein FASTA

462 aa · TkA03G440350|TK1151|PROTEIN

MVDRILIRYLRDDIPIESFDFKIDIENQELASHAIKWIRPVVIKTCLTKLFLEIMVTNDSFMLPDEILFSKNLNIVRIYCTSNVHFIWMSSRPVINSVSLRELDLKHVYIREKVLDDIFSTCCLLEKIKLIDCKGFKTIKVKNLCSLYELAIVSDESDGSVLEIDHVPKLRLFSCDIRFVTLPANPLTFNLVTQLSLVTGLGLGDHLGMDYTYLDMIVLKFPLLRNLTLYLRSWISESFHFTCASMTTLSLMRCPKSLIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G440350`
TK1151 ID	TkA03G440350
OH-1004 ID	LXL04_009461
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 99.784 / OH-1004 86.424 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G440350`
Location	Chr03:109703168-109709729 (+)
Description	Similar to At3g28410: Putative F-box/LRR-repeat protein At3g28410
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009461` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT3G28410 ath:AT3G58930 ath:AT5G02700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.912

Rank 1 · TkA03G440350 · TK1151

Cytoplasm0.142

Rank 2 · TkA03G440350 · TK1151

Cell membrane0.031

Rank 3 · TkA03G440350 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA03G440350 · TK1151

Plastid0.012

Rank 5 · TkA03G440350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF128-176 aa

PF24758LRR_At5g5637048-170 aa

PF24758LRR_At5g56370218-316 aa

PF23622LRR_At1g61320_AtMIF1244-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G440350	`PF23622`	LRR_At1g61320_AtMIF1	28	176	1.8e-10	41.5
TkA03G440350	`PF24758`	LRR_At5g56370	48	170	5.1e-10	40.1
TkA03G440350	`PF24758`	LRR_At5g56370	218	316	5.1e-10	40.1
TkA03G440350	`PF23622`	LRR_At1g61320_AtMIF1	244	330	1.8e-10	41.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card