TkA03G439800 | RubberDandelionOmics

Gene overview

TkA03G439800

Reference: TK1151 Chr: Chr03 Coordinates: 109389769-109392873 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1783 bp · TkA03G439800|TK1151|cDNA

CACCTCGCTTGGAGTCAAAGAGAAGAAACCCCAAGAACACAACTAAAAGTTGACCATCTCCGCTTCCAAATATAACAAAAACGCCAACTTTCTCTAGTTTCACGAACGATTTGAAAAGAATTCCAAAAAACAAAGAGCAGTACAAGAATGCCTACCGTAGTTTTCAAAGAATTTCAAGAAAATCTATCTACTCACTTTAGACCATGGCAACGATCCTTCCAATTCTGGGCCAGGGCTGCTGATATTTACGCTGGCTATAA...

CDS

Download CDS FASTA

1449 bp · TkA03G439800|TK1151|CDS

ATGCCTACCGTAGTTTTCAAAGAATTTCAAGAAAATCTATCTACTCACTTTAGACCATGGCAACGATCCTTCCAATTCTGGGCCAGGGCTGCTGATATTTACGCTGGCTATAAGGTGTTTCAATTTAGGGTTGGTTTTGAGAAAGACGTTGAAAAGGCAGAGGCAATGTGGGAGAGACACCATGAACATGCTGCTGACAAACTTTATTCCATGTGCTATGATATGGGTGGATTCTTTCTCAAGGTTGCTCAAGTTGTTGG...

Protein

Download Protein FASTA

482 aa · TkA03G439800|TK1151|PROTEIN

MPTVVFKEFQENLSTHFRPWQRSFQFWARAADIYAGYKVFQFRVGFEKDVEKAEAMWERHHEHAADKLYSMCYDMGGFFLKVAQVVGKPDLAPPAWVRKLVTLCDEAPKTPSNVVRLVLEKELDKTIEDMFERFEWDPIGSASIAQVHRARLKGDKKDVVVKVQHPGVQDLMMTDLRNLQAFALCLQKTDLKFDFFSVCKEMEKQIGYEFDFTREALAMDSIRSFLSENNKKMIVKVPRVIRNVVTRRVLVMEYIDGIPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G439800`
TK1151 ID	TkA03G439800
OH-1004 ID	LXL04_009432
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 92.324 / OH-1004 89.178 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G439800

Location Chr03:109389769-109392873 (-)

Description Similar to adck1: AarF domain-containing protein kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64940`	May participate in responses to oxidative stress, high light and heavy metals.	Loss of the Atypical Kinases ABC1K7 and ABC1K8 Changes the Lipid Composition of the Chloroplast Membrane.2015 · DOI: 10.1093/pcp/pcv046
`At5g05200`	Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007005 mitochondrion organization Biological Process

GO:0010637 negative regulation of mitochondrial fusion Biological Process

GO:0055088 lipid homeostasis Biological Process

GO:1903852 positive regulation of cristae formation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

gga:423382

hsa:57143

mmu:72113

xla:443831

xtr:496824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.836

Rank 1 · TkA03G439800 · TK1151

Mitochondrion0.154

Rank 2 · TkA03G439800 · TK1151

Cytoplasm0.060

Rank 3 · TkA03G439800 · TK1151

Nucleus0.035

Rank 4 · TkA03G439800 · TK1151

Cell membrane0.029

Rank 5 · TkA03G439800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01636APH64-133 aa

PF03109ABC1103-355 aa

PF27344MJECL34119-180 aa

PF00069Pkinase138-164 aa

PF01163RIO1161-182 aa

PF27344MJECL34200-232 aa

PF07253Gypsy208-268 aa

PF04183IucA_IucC212-260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G439800	`PF01636`	APH	64	133	0.00085	19.9
TkA03G439800	`PF03109`	ABC1	103	355	1.7e-63	214.8
TkA03G439800	`PF27344`	MJECL34	119	180	0.12	12.7
TkA03G439800	`PF00069`	Pkinase	138	164	1.6e-05	25.2
TkA03G439800	`PF01163`	RIO1	161	182	1.3e-05	25.6
TkA03G439800	`PF27344`	MJECL34	200	232	0.12	12.7
TkA03G439800	`PF07253`	Gypsy	208	268	0.11	11.8
TkA03G439800	`PF04183`	IucA_IucC	212	260	0.1	12.8
TkA03G439800	`PF01636`	APH	214	262	0.00085	19.9
TkA03G439800	`PF00069`	Pkinase	225	334	1.6e-05	25.2
TkA03G439800	`PF01163`	RIO1	233	335	1.3e-05	25.6
TkA03G439800	`PF01636`	APH	299	327	0.00085	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y08`	Arabidopsis thaliana	sp\|Q93Y08\|AB1K8_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic	29.900%	Swiss-Prot	Low
`Q9ASX5`	Arabidopsis thaliana	sp\|Q9ASX5\|Y5520_ARATH Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic	33.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card