TkA03G439300 | RubberDandelionOmics

Gene overview

TkA03G439300

Reference: TK1151 Chr: Chr03 Coordinates: 109272052-109272360 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA03G439300|TK1151|cDNA

AAGGTGGCAAGGAAGTCTGCTCCGGCAACCGGAGGAGTGAAGAAGCCCCATAGGTTCAGGCCTGGAACCGTCGCCCTGAGGGAAATCAGAAAGTACCAGAAGAGCACCGAATCGTTGATCAGGAAACTCCAGAGGCTTGTGAGGGAAATCGCACAGGATTTCAAAACCGATCTGCGTTTCCAGAGCTCCGCCGTCGCGACTCTCCAGGAGGCGTCAGAAGCAGGGGCGGCACCAGGCTACTCCTTAGATATTGCAAAGAA...

CDS

Download CDS FASTA

309 bp · TkA03G439300|TK1151|CDS

AAGGTGGCAAGGAAGTCTGCTCCGGCAACCGGAGGAGTGAAGAAGCCCCATAGGTTCAGGCCTGGAACCGTCGCCCTGAGGGAAATCAGAAAGTACCAGAAGAGCACCGAATCGTTGATCAGGAAACTCCAGAGGCTTGTGAGGGAAATCGCACAGGATTTCAAAACCGATCTGCGTTTCCAGAGCTCCGCCGTCGCGACTCTCCAGGAGGCGTCAGAAGCAGGGGCGGCACCAGGCTACTCCTTAGATATTGCAAAGAA...

Protein

Download Protein FASTA

102 aa · TkA03G439300|TK1151|PROTEIN

KVARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTESLIRKLQRLVREIAQDFKTDLRFQSSAVATLQEASEAGAAPGYSLDIAKKMKDQRSGVFLCFYFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G439300`
TK1151 ID	TkA03G439300
OH-1004 ID	LXL04_019711
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 81.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G439300

Location Chr03:109272052-109272360 (-)

Description Similar to B34: Histone H3.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P59226`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019711 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0031492 nucleosomal DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0866200

dosa:Os04g0419600

dosa:Os05g0438700

dosa:Os06g0160100

dosa:Os11g0155900

nta:107759185

nta:107759464

nta:107763111

nta:107769564

nta:107794615

nta:107798424

nta:107816172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA03G439300 · TK1151

Nucleus0.321

Rank 2 · TkA03G439300 · TK1151

Mitochondrion0.189

Rank 3 · TkA03G439300 · TK1151

Cell membrane0.059

Rank 4 · TkA03G439300 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA03G439300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31036mS6513-102 aa

PF00125Histone21-74 aa

PF06175MiaE22-58 aa

PF04912Dynamitin27-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G439300	`PF31036`	mS65	13	102	0.016	16.0
TkA03G439300	`PF00125`	Histone	21	74	3.9e-13	50.3
TkA03G439300	`PF06175`	MiaE	22	58	0.044	14.3
TkA03G439300	`PF04912`	Dynamitin	27	71	0.1	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59226`	Arabidopsis thaliana	sp\|P59226\|H31_ARATH Histone H3.1	92.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card