TkA03G435160 | RubberDandelionOmics

Gene overview

TkA03G435160

Reference: TK1151 Chr: Chr03 Coordinates: 108278517-108280131 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · TkA03G435160|TK1151|cDNA

ATGGTCGAATTTTGGGTTTCTTGGAGGAAGAAAGAGAAGATGAGGAGACGAGGAAATTTTGGGCATATCGACTCTAAACGGAAGAGTGACGGCGCACCGATGGCGGCAACGTGGCAATTAGTTAACGACGCAGGAAAAGCCGTTGGATTTAAACTACTTCAACTTGCTAGAAGAAACATGGCAGAGCATCAAGTAATCGAGTTAAAGAGATGGTTCAATGAGGTTGCGTATCTGCGTAACAAGATTTATGAAGCTGAGAA...

CDS

Download CDS FASTA

792 bp · TkA03G435160|TK1151|CDS

ATGGTCGAATTTTGGGTTTCTTGGAGGAAGAAAGAGAAGATGAGGAGACGAGGAAATTTTGGGCATATCGACTCTAAACGGAAGAGTGACGGCGCACCGATGGCGGCAACGTGGCAATTAGTTAACGACGCAGGAAAAGCCGTTGGATTTAAACTACTTCAACTTGCTAGAAGAAACATGGCAGAGCATCAAGTAATCGAGTTAAAGAGATGGTTCAATGAGGTTGCGTATCTGCGTAACAAGATTTATGAAGCTGAGAA...

Protein

Download Protein FASTA

263 aa · TkA03G435160|TK1151|PROTEIN

MVEFWVSWRKKEKMRRRGNFGHIDSKRKSDGAPMAATWQLVNDAGKAVGFKLLQLARRNMAEHQVIELKRWFNEVAYLRNKIYEAEKELEQMKLDLIQLRRGVCQPFFNTRIAESTSPHTIYEINIQRVIRGEDLRTTLMIKNLPDMLTSEMLLDEINKHVRPGTYDFIYLPLYLLDKSNHEYAFINMIGSIHVVQLYNALNGKNWGIFRSGKAAALKYAKVQGKDALIEHFKYTKLKYQEKCFHPILFTNTGDQEPFPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G435160`
TK1151 ID	TkA03G435160
OH-1004 ID	LXL04_009412
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 77.947 / OH-1004 97.674 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G435160

Location Chr03:108278517-108280131 (-)

Description Similar to ML1: Protein MEI2-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61960`	Probable RNA-binding transcriptional activator that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At5g07290`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0517531`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0719800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os05g0102800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009412 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G07290

ath:AT5G61960

dosa:Os02g0517531

dosa:Os02g0719800

dosa:Os05g0102800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.462

Rank 1 · TkA03G435160 · TK1151

Cytoplasm0.382

Rank 2 · TkA03G435160 · TK1151

Cell membrane0.133

Rank 3 · TkA03G435160 · TK1151

Plastid0.049

Rank 4 · TkA03G435160 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA03G435160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20379DUF667451-101 aa

PF24980LSU57-60 aa

PF14703PHM7_cyt70-116 aa

PF24980LSU74-101 aa

PF04059RRM_2136-233 aa

PF14703PHM7_cyt137-166 aa

PF20379DUF6674215-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G435160	`PF20379`	DUF6674	51	101	0.47	10.7
TkA03G435160	`PF24980`	LSU	57	60	0.023	15.4
TkA03G435160	`PF14703`	PHM7_cyt	70	116	0.17	12.8
TkA03G435160	`PF24980`	LSU	74	101	0.023	15.4
TkA03G435160	`PF04059`	RRM_2	136	233	3.2e-32	111.3
TkA03G435160	`PF14703`	PHM7_cyt	137	166	0.17	12.8
TkA03G435160	`PF20379`	DUF6674	215	237	0.47	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4I9`	Arabidopsis thaliana	sp\|Q8W4I9\|AML1_ARATH Protein MEI2-like 1	50.000%	Swiss-Prot	Medium
`Q9LYN7`	Arabidopsis thaliana	sp\|Q9LYN7\|AML4_ARATH Protein MEI2-like 4	49.400%	Swiss-Prot	Medium
`Q64M78`	Oryza sativa subsp. japonica	sp\|Q64M78\|OML4_ORYSJ Protein MEI2-like 4	50.700%	Swiss-Prot	Medium
`Q6ZI17`	Oryza sativa subsp. japonica	sp\|Q6ZI17\|OML2_ORYSJ Protein MEI2-like 2	47.900%	Swiss-Prot	Medium
`Q75M35`	Oryza sativa subsp. japonica	sp\|Q75M35\|OML3_ORYSJ Protein MEI2-like 3	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card