TkA03G434780 | RubberDandelionOmics

Gene overview

TkA03G434780

Reference: TK1151 Chr: Chr03 Coordinates: 108190236-108196069 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · TkA03G434780|TK1151|cDNA

ATGGCTTTCTTTCGAATGGTCATTAACATAAATGAAGATAAAAAGCTCATGCCTATGGATGCAGAGTCCAGAAGACTAATTGACTGGATGGAGAAAGATGTATATGATGCTTTGCAGAAGAAATATCTCAGGGCACTAATGTTCTACATCTGCCACACAATAGAAAGGCCTAAGATTGAAGAATATTTTTGTGCGGTGCGGAAGCTGTTCTGTAATCTGAGTCTGGACAATGAAATCTCTGAATTAAAGAACTTCGACTT...

CDS

Download CDS FASTA

534 bp · TkA03G434780|TK1151|CDS

ATGGCTTTCTTTCGAATGGTCATTAACATAAATGAAGATAAAAAGCTCATGCCTATGGATGCAGAGTCCAGAAGACTAATTGACTGGATGGAGAAAGATGTATATGATGCTTTGCAGAAGAAATATCTCAGGGCACTAATGTTCTACATCTGCCACACAATAGAAAGGCCTAAGATTGAAGAATATTTTTGTGCGGTGCGGAAGCTGTTCTGTAATCTGAGTCTGGACAATGAAATCTCTGAATTAAAGAACTTCGACTT...

Protein

Download Protein FASTA

177 aa · TkA03G434780|TK1151|PROTEIN

MAFFRMVININEDKKLMPMDAESRRLIDWMEKDVYDALQKKYLRALMFYICHTIERPKIEEYFCAVRKLFCNLSLDNEISELKNFDFRAIPSLSGKYKIPIFELIKANVRDQVTRSHKQITQRLYTESILPKKTCCKNIKHPEVELNNKENPDLRTEVATETLEDFNLNHYHGFWLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G434780`
TK1151 ID	TkA03G434780
OH-1004 ID	LXL04_009410
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.900
Protein coverage (%)	TK1151 68.362 / OH-1004 96.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G434780

Location Chr03:108190236-108196069 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: F4HRV8`	Required for normal meiosis in male and female gametophytes.	No verified direct reference in this release
`At4g32200`	Required for normal meiosis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0506800`	Essential factor for meiotic homologous chromosome pairing (synapsis).	An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis.2004 · DOI: 10.1007/s00438-003-0934-z PAIR2 is essential for homologous chromosome synapsis in rice meiosis I.2006 · DOI: 10.1242/jcs.02736

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009410 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.359

Rank 1 · TkA03G434780 · TK1151

Nucleus0.327

Rank 2 · TkA03G434780 · TK1151

Mitochondrion0.273

Rank 3 · TkA03G434780 · TK1151

Cell membrane0.078

Rank 4 · TkA03G434780 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA03G434780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02301HORMA14-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G434780	`PF02301`	HORMA	14	68	3.4e-10	40.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HRV8`	Arabidopsis thaliana	sp\|F4HRV8\|ASY1_ARATH Meiosis-specific protein ASY1	79.600%	Swiss-Prot	Low
`F4JTJ9`	Arabidopsis thaliana	sp\|F4JTJ9\|ASY2_ARATH Meiosis-specific protein ASY2	75.500%	Swiss-Prot	Low
`Q76CY8`	Oryza sativa subsp. japonica	sp\|Q76CY8\|PAIR2_ORYSJ Meiosis-specific protein PAIR2	77.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card