TkA03G430260 | RubberDandelionOmics

Gene overview

TkA03G430260

Reference: TK1151 Chr: Chr03 Coordinates: 107063807-107065169 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1292 bp · TkA03G430260|TK1151|cDNA

AAAATAATGGTATTTTTGTTGTCGTTATCGTCTCTCTTTATGAATTGAAACAGAGATGACAAGCCCCAATAAAGAAACTCTATATCTTACCATAAATAGGAACTTCCCCCCCTACCATTGCTTTGTAATTCTCTGTCGCCCTTTTCCATTAAAACTCCCGAACACACTTCCCCCTTTTGGATTTTGCATAATCACCAAAAAGTGTCTAGTTTTGATGCCATTATTTTTGATGAATCCTCCTTCTGCATAGTCCAATATAT...

CDS

Download CDS FASTA

597 bp · TkA03G430260|TK1151|CDS

ATGGCATTGTCACCTTCGGGGTCGTCGAAACGGGTACGTTCGGAGGTTAATAACGCCGTTCAAGCAGCCACCTGCGTGGTGGATGGGTGCACGGCGGATCTTAGCAATTGCAGAAAGTATCACCAGCGTCATAAGGTTTGCGAAGTTCATTCCAAGAGCCCAGAGGTTTCAATCAAAGGCCAAAAGCTTCGATTCTGCCAGCAATGTAGCCGGTTCCATCCGCTAGATGAATTTGATGAGGGAAAACGGAGTTGCAGAAA...

Protein

Download Protein FASTA

198 aa · TkA03G430260|TK1151|PROTEIN

MALSPSGSSKRVRSEVNNAVQAATCVVDGCTADLSNCRKYHQRHKVCEVHSKSPEVSIKGQKLRFCQQCSRFHPLDEFDEGKRSCRKRLDGHNRRRRKPRPYIFPAHHHGTGVAPPIGPPVHTAMATPTTSSLVWSRSDHAPSLLSSSEASSSYTTLSHQSSDSFSATTNYRLDSGLGYGGLENHYEDPQTLSFYWQY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G430260`
TK1151 ID	TkA03G430260
OH-1004 ID	LXL04_009370
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G430260

Location Chr03:107063807-107065169 (+)

Description Similar to SPL13B: Squamosa promoter-binding-like protein 13B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50570`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`At5g50670`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0531600`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity).	No verified direct reference in this release
`UniProt: Q2R3Y1`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009620 response to fungus Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048653 anther development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G50570

ath:AT5G50670

dosa:Os08g0531600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.873

Rank 1 · TkA03G430260 · TK1151

Cytoplasm0.242

Rank 2 · TkA03G430260 · TK1151

Cell membrane0.029

Rank 3 · TkA03G430260 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA03G430260 · TK1151

Mitochondrion0.018

Rank 5 · TkA03G430260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110SBP25-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G430260	`PF03110`	SBP	25	98	1.4e-32	112.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DI20`	Arabidopsis thaliana	sp\|B9DI20\|SP13A_ARATH Squamosa promoter-binding-like protein 13A	70.400%	Swiss-Prot	Low
`P0DI11`	Arabidopsis thaliana	sp\|P0DI11\|SP13B_ARATH Squamosa promoter-binding-like protein 13B	70.400%	Swiss-Prot	Low
`Q6YZE8`	Oryza sativa subsp. japonica	sp\|Q6YZE8\|SPL16_ORYSJ Squamosa promoter-binding-like protein 16	72.800%	Swiss-Prot	Low
`Q2R3Y1`	Oryza sativa subsp. japonica	sp\|Q2R3Y1\|SPL19_ORYSJ Putative squamosa promoter-binding-like protein 19	73.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card