TkA03G430130 | RubberDandelionOmics

Gene overview

TkA03G430130

Reference: TK1151 Chr: Chr03 Coordinates: 107034788-107038704 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1567 bp · TkA03G430130|TK1151|cDNA

TTTCCGAGTTGATTTCTGAGTCGCAAAATTCCGCCATAGATACTTTCCCCAAGCTTGACGCTTCCTTCCTTCGCTTCAGAGTGTTTCCTGTTACTCCTTGATCGAATTTTTGCAGTGTTTGTTACTTTGTTTAATCTAATTTGGAGATGAACGGCGAGGAGTTGACTGAGCAGGAAACCGCTTTGTATGATCGCCAAATTAGGGTTTGGGGAGTTGATGCGCAAAGAAGGCTCAGCAAATCTCATATATTTGTCAGTGGA...

CDS

Download CDS FASTA

960 bp · TkA03G430130|TK1151|CDS

ATGAACGGCGAGGAGTTGACTGAGCAGGAAACCGCTTTGTATGATCGCCAAATTAGGGTTTGGGGAGTTGATGCGCAAAGAAGGCTCAGCAAATCTCATATATTTGTCAGTGGACTCAAAGGCACCGCCGTAGAGTTTTGCAAGAACATTGTTCTAGCAGGGGTAGGAAGTTTGACCTTGAACGATGATAATCCAGTCACTGAAGAAGCACTAGCTGCTAACTTTCTGATCCCTTTTGATGAAAACATGGGTGGTGGAGG...

Protein

Download Protein FASTA

319 aa · TkA03G430130|TK1151|PROTEIN

MNGEELTEQETALYDRQIRVWGVDAQRRLSKSHIFVSGLKGTAVEFCKNIVLAGVGSLTLNDDNPVTEEALAANFLIPFDENMGGGGSIAELCCDSLKDFNPMVHVSVEKGDLSSFDVDFFEKFDVVVISCCLLAAKKSVNEKCRKLSKRVAFYSVDCRYSCGEIFVDLHKYSYMKKKADETVECQLQYPSFEEAIAIPWRSLPKRVSKLYFAMRVVERFEEVERRKPGETSVDDLANVLKLRNELCLAHSLNESQIPDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G430130`
TK1151 ID	TkA03G430130
OH-1004 ID	LXL04_009369
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G430130

Location Chr03:107034788-107038704 (-)

Description Similar to SAE1B-2: SUMO-activating enzyme subunit 1B-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50580`	The dimeric enzyme acts as an E1 ligase for SUMO1 and SUMO2.	No verified direct reference in this release
`At5g50680`	The dimeric enzyme acts as an E1 ligase for SUMO1 and SUMO2.	No verified direct reference in this release
`At4g24940`	The dimeric enzyme acts as an E1 ligase for SUMO1 and SUMO2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009369 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016925 protein sumoylation Biological Process

GO:0061484 hematopoietic stem cell homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0031510 SUMO activating enzyme complex Cellular Component

GO:0019948 SUMO activating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT4G24940

ath:AT5G50580

ath:AT5G50680

bta:505512

dre:415148

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.590

Rank 1 · TkA03G430130 · TK1151

Nucleus0.498

Rank 2 · TkA03G430130 · TK1151

Mitochondrion0.067

Rank 3 · TkA03G430130 · TK1151

Cell membrane0.047

Rank 4 · TkA03G430130 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA03G430130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00899ThiF14-309 aa

PF13847Methyltransf_31105-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G430130	`PF00899`	ThiF	14	309	1.2e-22	80.9
TkA03G430130	`PF13847`	Methyltransf_31	105	161	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DI12`	Arabidopsis thaliana	sp\|P0DI12\|SA1B1_ARATH SUMO-activating enzyme subunit 1B-1	71.300%	Swiss-Prot	High
`P0DI13`	Arabidopsis thaliana	sp\|P0DI13\|SA1B2_ARATH SUMO-activating enzyme subunit 1B-2	71.300%	Swiss-Prot	High
`Q8VY78`	Arabidopsis thaliana	sp\|Q8VY78\|SAE1A_ARATH SUMO-activating enzyme subunit 1A	69.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card