RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G427390
Reference: TK1151 Chr: Chr03 Coordinates: 106307560-106309298 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1167 bp · TkA03G427390|TK1151|cDNA

GTCCCTTCAATCTTGAAATTTGTTTAGACTAAAGTTTGATGGATGATAAGTACTCAACTTGGATGCTATGTTGGAGTCAACAATCTCAGCCTTTCCTTACTATATATAGGAAGAAGAGGTTTGGTTATAATCAATTAAGGAAGATGACTGAGATCAAGATGGCTCACCTCACTCTTGCTTTTGGCCTTCTTGGCAATATTGTCTCGTTTATGGTTTTTCTCGCACCCATACCGACATTTTACAAAATTTACAAAAAGAAA...

CDS

Download CDS FASTA

966 bp · TkA03G427390|TK1151|CDS

ATGGATGATAAGTACTCAACTTGGATGCTATGTTGGAGTCAACAATCTCAGCCTTTCCTTACTATATATAGGAAGAAGAGGTTTGGTTATAATCAATTAAGGAAGATGACTGAGATCAAGATGGCTCACCTCACTCTTGCTTTTGGCCTTCTTGGCAATATTGTCTCGTTTATGGTTTTTCTCGCACCCATACCGACATTTTACAAAATTTACAAAAAGAAATCAACAGAAGGGTTTCAATCAGCGCCTTATGTGGTGGG...

Protein

Download Protein FASTA

321 aa · TkA03G427390|TK1151|PROTEIN

MDDKYSTWMLCWSQQSQPFLTIYRKKRFGYNQLRKMTEIKMAHLTLAFGLLGNIVSFMVFLAPIPTFYKIYKKKSTEGFQSAPYVVGLFSAMLWIYYAFLKTNVMLLITINSVGCIIETLYICFFLFYAPKKVRMESLKLIILLVIVGFGLIVVSTQFLATGVNRGVIVGWICLVFSLCVFVAPLGVLRQVIKTKSVEYMPILLSVALTLSAVMWFFYGLLLGDFNIAIPNVLGFTFGIIQMILYFAYKNNKLITNEKVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G427390
TK1151 IDTkA03G427390
OH-1004 IDLXL04_009338
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G427390
LocationChr03:106307560-106309298 (+)
DescriptionSimilar to SWEET14: Bidirectional sugar transporter SWEET14
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g50790 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BKP4 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os11g0508600 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606
Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
Os12g0476200 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009338 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008643 carbohydrate transport Biological Process
GO:0009555 pollen development Biological Process
GO:0009901 anther dehiscence Biological Process
GO:0015770 sucrose transport Biological Process
GO:0048571 long-day photoperiodism Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0008515 sucrose transmembrane transporter activity Molecular Function
GO:0051119 sugar transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT5G50790
dosa:Os11g0508600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.605
Rank 1 · TkA03G427390 · TK1151
Endoplasmic reticulum0.166
Rank 2 · TkA03G427390 · TK1151
Lysosome / Vacuole0.147
Rank 3 · TkA03G427390 · TK1151
Cytoplasm0.101
Rank 4 · TkA03G427390 · TK1151
Golgi apparatus0.078
Rank 5 · TkA03G427390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv48-132 aa
PF04193PQ-loop50-101 aa
PF22258DUF694955-95 aa
PF11992TgpA_N85-184 aa
PF04193PQ-loop107-126 aa
PF28012YnhF141-154 aa
PF04193PQ-loop167-182 aa
PF03083MtN3_slv168-252 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G427390PF03083MtN3_slv481322.1e-54182.2
TkA03G427390PF04193PQ-loop501010.0001622.1
TkA03G427390PF22258DUF694955950.01516.2
TkA03G427390PF11992TgpA_N851844.66.8
TkA03G427390PF04193PQ-loop1071260.0001622.1
TkA03G427390PF28012YnhF1411541.110.0
TkA03G427390PF04193PQ-loop1671820.0001622.1
TkA03G427390PF03083MtN3_slv1682522.1e-54182.2
TkA03G427390PF11992TgpA_N1692274.66.8
TkA03G427390PF22258DUF69491742190.01516.2
TkA03G427390PF04193PQ-loop1912240.0001622.1
TkA03G427390PF04193PQ-loop2332450.0001622.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LUE3Arabidopsis thalianasp|Q9LUE3|SWT10_ARATH Bidirectional sugar transporter SWEET1059.200%Swiss-ProtHigh
B8BKP4Oryza sativa subsp. indicasp|B8BKP4|SWT14_ORYSI Bidirectional sugar transporter SWEET1462.400%Swiss-ProtHigh
Q2R3P9Oryza sativa subsp. japonicasp|Q2R3P9|SWT14_ORYSJ Bidirectional sugar transporter SWEET1462.400%Swiss-ProtHigh
Q2QR07Oryza sativa subsp. japonicasp|Q2QR07|SWT13_ORYSJ Bidirectional sugar transporter SWEET1358.800%Swiss-ProtHigh

JBrowse

View in Genome Browser