TkA03G424720 | RubberDandelionOmics

Gene overview

TkA03G424720

Reference: TK1151 Chr: Chr03 Coordinates: 105747922-105751060 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · TkA03G424720|TK1151|cDNA

ATGACAGTATCAATAACAGGAGCTACTGGTTTTATAGGGAGTAAATTGGTGCAAAGGCTCTATGAAGATAATCATAGTATCTGTGTCCTGACTCGGTCTATATCTAAAGCTCAGTCCATTTTTCCGGTGAAGGATTTCCCAGGCATTGTGATTGCAGAGGAGGCCCAATGGAAAGAGTGCATTGAAGGGTCAACTGGAGTTGTGAACTTGGCTGGGTTGCCCATTAGTACAAGATGGTATCCTGAGGTGAAGAAAGAGAT...

CDS

Download CDS FASTA

966 bp · TkA03G424720|TK1151|CDS

ATGACAGTATCAATAACAGGAGCTACTGGTTTTATAGGGAGTAAATTGGTGCAAAGGCTCTATGAAGATAATCATAGTATCTGTGTCCTGACTCGGTCTATATCTAAAGCTCAGTCCATTTTTCCGGTGAAGGATTTCCCAGGCATTGTGATTGCAGAGGAGGCCCAATGGAAAGAGTGCATTGAAGGGTCAACTGGAGTTGTGAACTTGGCTGGGTTGCCCATTAGTACAAGATGGTATCCTGAGGTGAAGAAAGAGAT...

Protein

Download Protein FASTA

321 aa · TkA03G424720|TK1151|PROTEIN

MTVSITGATGFIGSKLVQRLYEDNHSICVLTRSISKAQSIFPVKDFPGIVIAEEAQWKECIEGSTGVVNLAGLPISTRWYPEVKKEIKESRVRVTSKSVIIFVVASSTNKEDTKFKRFWIQSNPRKCSSGEDVQVVENGDVEMSKFKDGNHIEWRDTEYKNLLRDSATTTTTPQFDNAMKLFREYDVEAYNWVKTIPPEQWSTSHFSGKAKTDNLTSNFCKKIGSLENDYLDHNWIIYGAPWTTWVDHGPMWGIGGQKES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G424720`
TK1151 ID	TkA03G424720
OH-1004 ID	LXL04_036339
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 47.352 / OH-1004 6.569 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G424720

Location Chr03:105747922-105751060 (+)

Description Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21280`	Putative NADP-dependent oxidoreductase that acts as a positive regulator of chloroplast division.	GIANT CHLOROPLAST 1 is essential for correct plastid division in Arabidopsis.2004 · DOI: 10.1016/j.cub.2004.04.031

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · TkA03G424720 · TK1151

Nucleus0.237

Rank 2 · TkA03G424720 · TK1151

Mitochondrion0.164

Rank 3 · TkA03G424720 · TK1151

Peroxisome0.111

Rank 4 · TkA03G424720 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA03G424720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04321RmlD_sub_bind1-33 aa

PF05368NmrA2-38 aa

PF00106adh_short2-39 aa

PF01118Semialdhyde_dh3-27 aa

PF02719Polysacc_synt_23-33 aa

PF01370Epimerase4-95 aa

PF07993NAD_binding_45-38 aa

PF16363GDP_Man_Dehyd5-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G424720	`PF04321`	RmlD_sub_bind	1	33	0.26	11.0
TkA03G424720	`PF05368`	NmrA	2	38	0.0012	19.2
TkA03G424720	`PF00106`	adh_short	2	39	0.15	12.2
TkA03G424720	`PF01118`	Semialdhyde_dh	3	27	0.042	14.9
TkA03G424720	`PF02719`	Polysacc_synt_2	3	33	0.26	11.1
TkA03G424720	`PF01370`	Epimerase	4	95	3.3e-08	34.0
TkA03G424720	`PF07993`	NAD_binding_4	5	38	0.00044	20.2
TkA03G424720	`PF16363`	GDP_Man_Dehyd	5	36	0.0013	19.0
TkA03G424720	`PF01073`	3Beta_HSD	5	73	0.045	13.5
TkA03G424720	`PF13460`	NAD_binding_10	7	68	0.0025	18.4
TkA03G424720	`PF16363`	GDP_Man_Dehyd	130	190	0.0013	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJU9`	Arabidopsis thaliana	sp\|Q9SJU9\|GC1_ARATH Epimerase family protein SDR39U1 homolog, chloroplastic	77.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card