Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2664 bp · TkA03G420670|TK1151|cDNA
ATGAAAATACAGGATTTTCACAAATTAAACGCTTATGAACTCACCAACCTTTGTGCTGACACTTTCAGAACTCATACAATCTCAGTCCCTAAGGCTGGAACAACCTCTGAACAAAGAGATAAATTCTTAGAATACAAAGATAAAGTAAAACAATACAAAACCAGAAGAGGATCCAAAGCTGCCGAAACGTCAGGCAAAAACTATGTCGCTAGCATGCGAGTTCGAGTCCCTGAAGAGGATCGAGACATAGATCGCATAAT...
2664 bp · TkA03G420670|TK1151|CDS
ATGAAAATACAGGATTTTCACAAATTAAACGCTTATGAACTCACCAACCTTTGTGCTGACACTTTCAGAACTCATACAATCTCAGTCCCTAAGGCTGGAACAACCTCTGAACAAAGAGATAAATTCTTAGAATACAAAGATAAAGTAAAACAATACAAAACCAGAAGAGGATCCAAAGCTGCCGAAACGTCAGGCAAAAACTATGTCGCTAGCATGCGAGTTCGAGTCCCTGAAGAGGATCGAGACATAGATCGCATAAT...
Protein
Download Protein FASTA887 aa · TkA03G420670|TK1151|PROTEIN
MKIQDFHKLNAYELTNLCADTFRTHTISVPKAGTTSEQRDKFLEYKDKVKQYKTRRGSKAAETSGKNYVASMRVRVPEEDRDIDRIIITTTRTDLVDTRARSTDVERGIAGLPGQTDATNTLALLAEGRSNLTIPPKRRGRPTGTGGTPPVFDPVAMEAMIAERVTSAVVAYEIANPINNNGGGGGAGNPGGSGGNPRSCSYKDFMNYKPLKFAGTGGVIELTRWFEKTESVFQISSYTADCQVKFAACTFIHAALSWWN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G420670 |
|---|---|
| TK1151 ID | TkA03G420670 |
| OH-1004 ID | LXL04_029892 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 61.100 |
| Protein coverage (%) | TK1151 83.991 / OH-1004 68.579Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G420670 |
|---|---|
| Location | Chr03:104736379-104741087 (+) |
| Description | Similar to pol: Retrovirus-related Pol polyprotein from transposon 17.6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function |
| KEGG gene cross-reference | sce:YIL082W-A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03732PEG10_N-capsid212-287 aaPF17308Corazonin333-400 aaPF00098zf-CCHC424-429 aaPF16366CEBP_ZZ430-454 aaPF00098zf-CCHC441-454 aaPF00098zf-CCHC477-488 aaPF00078RVT_1600-703 aaPF31073DUF8803831-878 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G420670 | PF03732 | PEG10_N-capsid | 212 | 287 | 4e-07 | 31.0 |
| TkA03G420670 | PF17308 | Corazonin | 333 | 400 | 0.015 | 16.4 |
| TkA03G420670 | PF00098 | zf-CCHC | 424 | 429 | 0.24 | 12.3 |
| TkA03G420670 | PF16366 | CEBP_ZZ | 430 | 454 | 0.83 | 10.6 |
| TkA03G420670 | PF00098 | zf-CCHC | 441 | 454 | 0.24 | 12.3 |
| TkA03G420670 | PF00098 | zf-CCHC | 477 | 488 | 0.24 | 12.3 |
| TkA03G420670 | PF00078 | RVT_1 | 600 | 703 | 3e-20 | 73.7 |
| TkA03G420670 | PF31073 | DUF8803 | 831 | 878 | 3.3e-05 | 24.4 |
| TkA03G420670 | PF24626 | SH3_Tf2-1 | 834 | 884 | 1.3e-17 | 64.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.