TkA03G416120 | RubberDandelionOmics

Gene overview

TkA03G416120

Reference: TK1151 Chr: Chr03 Coordinates: 103527927-103530158 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1923 bp · TkA03G416120|TK1151|cDNA

ACGAACCTTACAAATTTATAAAGTACAGTTAAAAGTATATCATGTGACAATGTTCTTCCTTCACAAAGGACAAGCAAGAAAATGATTAGGAGATGAAAAAACAGTAGTTTGGTTTACCAAACTGGACTGCATAAAGGGTCCATCAAAGTAGAAATACATAAAATTGCTATTGGTAAGTGTTAAAGATGGACGAATAGATTGGTGATGATATATCGATGATAAATGAATGAAGATATATAATATCTACAATAATTTGAAAG...

CDS

Download CDS FASTA

1404 bp · TkA03G416120|TK1151|CDS

ATGTCCATTATCTCCACTTTAAAGAATATATTGGAAGGCCATTTGTATGCAGGTTCCAATCCCGCATTAAAACTTATCTTAATAACCATACTCATATGTATTCTTTTGTTAGGTTCCTACATGACTAAAAAAAAATCATGCGGGGTTTATTTAATAGACTTTGCATGTTACAAGCCCCCAGATGCTCAAAAGGTCACAAAGCAAACGTGTATCGAGAATCTAAAGCATATGGGAGTTTACTCAGAAGAAATGATGCGGTT...

Protein

Download Protein FASTA

467 aa · TkA03G416120|TK1151|PROTEIN

MSIISTLKNILEGHLYAGSNPALKLILITILICILLLGSYMTKKKSCGVYLIDFACYKPPDAQKVTKQTCIENLKHMGVYSEEMMRFMRKVLDKSGIGDTTYVPEVFLKKDCDPCMKDARREIEMSVFGSIDMLLAKTGVRCEDIGILIVNCCVYNTMPSLSSMIVNKYKLRDNIISYNVVGMGCSAGLRAIGLAEKLLQVHHDSYALVMSTEGVTESCYLGDVRSKLLANGIFRVGGAAILLSNRPSDHHNCKYKLIHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G416120`
TK1151 ID	TkA03G416120
OH-1004 ID	LXL04_009292
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G416120

Location Chr03:103527927-103530158 (-)

Description Similar to KCS2: 3-ketoacyl-CoA synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43760`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
`At1g04220`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 The DAISY gene from Arabidopsis encodes a fatty acid elongase condensing enzyme involved in the biosynthesis of aliphatic suberin in roots and the chalaza-micropyle region of seeds.2009 · DOI: 10.1111/j.1365-313x.2008.03674.x Two Arabidopsis 3-ketoacyl CoA synthase genes, KCS20 and KCS2/DAISY, are functionally redundant in cuticular wax and root suberin biosynthesis, but differentially controlled by osmotic stress.2009 · DOI: 10.1111/j.1365-313x.2009.03973.x
`At2g26640`	Active on both saturated and mono-unsaturated acyl chains C16 to C20.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g19440`	3-ketoacyl-CoA synthase 4.	No verified direct reference in this release
`At4g34510`	Active on saturated acyl-CoAs up to C22.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009292 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G04220

ath:AT1G19440

ath:AT2G26640

ath:AT4G34510

ath:AT5G43760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.725

Rank 1 · TkA03G416120 · TK1151

Cell membrane0.152

Rank 2 · TkA03G416120 · TK1151

Cytoplasm0.100

Rank 3 · TkA03G416120 · TK1151

Lysosome / Vacuole0.055

Rank 4 · TkA03G416120 · TK1151

Golgi apparatus0.049

Rank 5 · TkA03G416120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA44-330 aa

PF02797Chal_sti_synt_C81-99 aa

PF08541ACP_syn_III_C135-150 aa

PF03255ACCA168-216 aa

PF08541ACP_syn_III_C345-427 aa

PF02797Chal_sti_synt_C350-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G416120	`PF08392`	FAE1_CUT1_RppA	44	330	8.8e-110	367.3
TkA03G416120	`PF02797`	Chal_sti_synt_C	81	99	3.6e-06	27.8
TkA03G416120	`PF08541`	ACP_syn_III_C	135	150	1.1e-11	45.5
TkA03G416120	`PF03255`	ACCA	168	216	0.17	11.7
TkA03G416120	`PF08541`	ACP_syn_III_C	345	427	1.1e-11	45.5
TkA03G416120	`PF02797`	Chal_sti_synt_C	350	426	3.6e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG87`	Arabidopsis thaliana	sp\|Q9FG87\|KCS20_ARATH 3-ketoacyl-CoA synthase 20	50.500%	Swiss-Prot	High
`Q5XEP9`	Arabidopsis thaliana	sp\|Q5XEP9\|KCS2_ARATH 3-ketoacyl-CoA synthase 2	49.000%	Swiss-Prot	Medium
`O48780`	Arabidopsis thaliana	sp\|O48780\|KCS11_ARATH 3-ketoacyl-CoA synthase 11	51.400%	Swiss-Prot	High
`Q9LN49`	Arabidopsis thaliana	sp\|Q9LN49\|KCS4_ARATH 3-ketoacyl-CoA synthase 4	47.300%	Swiss-Prot	Medium
`O65677`	Arabidopsis thaliana	sp\|O65677\|KCS17_ARATH 3-ketoacyl-CoA synthase 17	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card