TkA03G412700 | RubberDandelionOmics

Gene overview

TkA03G412700

Reference: TK1151 Chr: Chr03 Coordinates: 102651597-102654157 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1858 bp · TkA03G412700|TK1151|cDNA

CTGTACTCCATTTCCGTATCATAATAGTTACCGTTATTAGCAACAAAACTCAAACACATAAATCCAACGTCTTAATTCCACTTCCCAAGTGCCCAACACTTTCCCCGAAGCCATTATTTTCAAATTCAAACTCACCCTTCTTAATCCTTACCATCTATGGCATCAAGTAGTTAACTCTTTACCCCCTCTATCTCTTCATCGCCTCTCAAATGGCACCAACTCCATACAGTTCCCTCTACGACAACCCCCTTACGGAGCTC...

CDS

Download CDS FASTA

1182 bp · TkA03G412700|TK1151|CDS

ATGGCACCAACTCCATACAGTTCCCTCTACGACAACCCCCTTACGGAGCTCAAACACAGTCGGAGCTCCAGTGAATGCAACAATGGCGTTTTGACCGTTCACAATCGTCAAAACAAAGAGAACTCGGAGCCGAATAAAGTGAAGACAAACTCGGGTCCTGTTGTGGATAAGGAGAATGTGGATTCTAACATAATTGGGTGTAAACCAGCACCAATCGCGAAATCCCGTTTGAAAGATAGGGATTGGAAACCGTCTTCGTT...

Protein

Download Protein FASTA

393 aa · TkA03G412700|TK1151|PROTEIN

MAPTPYSSLYDNPLTELKHSRSSSECNNGVLTVHNRQNKENSEPNKVKTNSGPVVDKENVDSNIIGCKPAPIAKSRLKDRDWKPSSLQLCMQLDDPIPNFGTSFYEPIDSAKNNSGNIWDYSDSEAAPASSWSTLPNRSLLCRPLPVDIGRCTCIIVKEKSVDGINGGSVYTLYTNEGQGRQNRKLAVALHRRHNGRSEFIIAQNTKGILCFADDSYVGSVTANLMGSKYHIWDQGRRLNSMTKHSKLLAVVSFVPTIAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G412700`
TK1151 ID	TkA03G412700
OH-1004 ID	LXL04_009244
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G412700

Location Chr03:102651597-102654157 (-)

Description Similar to TULP8: Tubby-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16070`	Tubby-like protein 8.	No verified direct reference in this release
`At2g18280`	Tubby-like F-box protein 2.	No verified direct reference in this release
`At2g47900`	Involved in abiotic stress signaling.	The subcellular localization of Tubby-like proteins and participation in stress signaling and root colonization by the mutualist Piriformospora indica.2012 · DOI: 10.1104/pp.112.201319

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0179400`	Tubby-like protein 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009244 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0008277 regulation of G protein-coupled receptor signaling pathway Biological Process

GO:0009620 response to fungus Biological Process

GO:0045879 negative regulation of smoothened signaling pathway Biological Process

GO:0061512 protein localization to cilium Biological Process

GO:0097499 protein localization to non-motile cilium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G16070

cqu:CpipJ_CPIJ006491

cqu:CpipJ_CPIJ017614

hsa:7289

osa:107276884

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA03G412700 · TK1151

Nucleus0.313

Rank 2 · TkA03G412700 · TK1151

Cell membrane0.228

Rank 3 · TkA03G412700 · TK1151

Endoplasmic reticulum0.088

Rank 4 · TkA03G412700 · TK1151

Golgi apparatus0.082

Rank 5 · TkA03G412700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12043DUF352724-65 aa

PF01167Tub141-387 aa

PF12043DUF3527334-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G412700	`PF12043`	DUF3527	24	65	0.011	16.1
TkA03G412700	`PF01167`	Tub	141	387	8.9e-49	167.2
TkA03G412700	`PF12043`	DUF3527	334	387	0.011	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9M8`	Arabidopsis thaliana	sp\|Q9S9M8\|TLP8_ARATH Tubby-like protein 8	53.300%	Swiss-Prot	High
`Q8GVE5`	Arabidopsis thaliana	sp\|Q8GVE5\|TLP2_ARATH Tubby-like F-box protein 2	25.500%	Swiss-Prot	Low
`Q8VY21`	Arabidopsis thaliana	sp\|Q8VY21\|TLP3_ARATH Tubby-like F-box protein 3	24.700%	Swiss-Prot	Low
`Q6ETL2`	Oryza sativa subsp. japonica	sp\|Q6ETL2\|TLP4_ORYSJ Tubby-like protein 4	62.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card