TkA03G408910 | RubberDandelionOmics

Gene overview

TkA03G408910

Reference: TK1151 Chr: Chr03 Coordinates: 101652443-101653443 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

902 bp · TkA03G408910|TK1151|cDNA

CAACCCTCCTACCTTATACATGTCCTACCTTCTCACTCAGACAATATAACAAACACCTTCACGACAATCAAAATCTCTTGCACATTACAAATCACCATGGCTAGATCTCAACAACGATACCGAGGCGTTCGACAAAGACATTGGGGATCTTGGGTCTCTGAAATTCGCCACCCTCTCCTGAAGACAAGAATCTGGCTGGGGACATTCGAGACGGCAGAGGACGCAGCCAGAGCGTACGACGAAGCAGCAAGGCTCATGTG...

CDS

Download CDS FASTA

630 bp · TkA03G408910|TK1151|CDS

CAACCCTCCTACCTTATACATGTCCTACCTTCTCACTCAGACAATATAACAAACACCTTCACGACAATCAAAATCTCTTGCACATTACAAATCACCATGGCTAGATCTCAACAACGATACCGAGGCGTTCGACAAAGACATTGGGGATCTTGGGTCTCTGAAATTCGCCACCCTCTCCTGAAGACAAGAATCTGGCTGGGGACATTCGAGACGGCAGAGGACGCAGCCAGAGCGTACGACGAAGCAGCAAGGCTCATGTG...

Protein

Download Protein FASTA

209 aa · TkA03G408910|TK1151|PROTEIN

QPSYLIHVLPSHSDNITNTFTTIKISCTLQITMARSQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDEAARLMCGTRARTNFNHDGEGSQSSSSSSTLLSAALRAKLHKCHLASLAMTKKPMVGHQEYQETQHQSPCSDTGEGFMDNSGNFGNILKWDGKMENMQQYKSSEDEHIEQMIEELLDYGTIEFCSVLQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G408910`
TK1151 ID	TkA03G408910
OH-1004 ID	LXL04_005341
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.600
Protein coverage (%)	TK1151 84.689 / OH-1004 98.953 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G408910

Location Chr03:101652443-101653443 (-)

Description Similar to ERF003: Ethylene-responsive transcription factor ERF003

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g15360`	Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis.	No verified direct reference in this release
`At5g25390`	Promotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005341 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010166 wax metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:1904278 positive regulation of wax biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G15360

ath:AT5G25190

ath:AT5G25390

zma:100282301

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA03G408910 · TK1151

Cytoplasm0.144

Rank 2 · TkA03G408910 · TK1151

Cell membrane0.031

Rank 3 · TkA03G408910 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA03G408910 · TK1151

Plastid0.021

Rank 5 · TkA03G408910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP239-88 aa

PF11074DUF2779127-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G408910	`PF00847`	AP2	39	88	2.2e-12	47.8
TkA03G408910	`PF11074`	DUF2779	127	198	0.16	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AW5`	Arabidopsis thaliana	sp\|Q94AW5\|ERF03_ARATH Ethylene-responsive transcription factor ERF003	59.000%	Swiss-Prot	High
`Q9XI33`	Arabidopsis thaliana	sp\|Q9XI33\|WIN1_ARATH Ethylene-responsive transcription factor WIN1	57.400%	Swiss-Prot	Low
`Q3E958`	Arabidopsis thaliana	sp\|Q3E958\|SHN3_ARATH Ethylene-responsive transcription factor SHINE 3	61.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card