TkA03G408880 | RubberDandelionOmics

Gene overview

TkA03G408880

Reference: TK1151 Chr: Chr03 Coordinates: 101628451-101633380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3215 bp · TkA03G408880|TK1151|cDNA

CTCAATAATCATGACTACCTTCACTCTCTGATTCCCTTACTTTTTATTCATCAATCTTTTTTACTGTCACCCGGCCTTTTTGCAATTACTGACGCCACAATGGCTTCCGGCATCACCTGGGATGATATCATGAAGGAGACTGTTGATCTTGAGCATATGCCTATGGATGAGCTCTTCGATCAATTGAAATGCACCAAACAGGGATTATCCGGTGAAGAAGGCAGGCGTAGGCTTGGCATTTTTGGTCCCAATAAGTTGGA...

CDS

Download CDS FASTA

2856 bp · TkA03G408880|TK1151|CDS

CTCAATAATCATGACTACCTTCACTCTCTGATTCCCTTACTTTTTATTCATCAATCTTTTTTACTGTCACCCGGCCTTTTTGCAATTACTGACGCCACAATGGCTTCCGGCATCACCTGGGATGATATCATGAAGGAGACTGTTGATCTTGAGCATATGCCTATGGATGAGCTCTTCGATCAATTGAAATGCACCAAACAGGGATTATCCGGTGAAGAAGGCAGGCGTAGGCTTGGCATTTTTGGTCCCAATAAGTTGGA...

Protein

Download Protein FASTA

951 aa · TkA03G408880|TK1151|PROTEIN

LNNHDYLHSLIPLLFIHQSFLLSPGLFAITDATMASGITWDDIMKETVDLEHMPMDELFDQLKCTKQGLSGEEGRRRLGIFGPNKLEEKKENKLLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGITTLLIINSTISFIEENNAGNAAAALMAGLAPKTKLLRDGKWSEEEAAELVPGDIISIKLGDIVPADARLLEGDPLKIDQAALTGESLPVTKKPGDGVFSGSTCKQGEIEAVVIATGVHTFFGKAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G408880`
TK1151 ID	TkA03G408880
OH-1004 ID	LXL04_032030
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.900
Protein coverage (%)	TK1151 91.167 / OH-1004 91.090 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G408880

Location Chr03:101628451-101633380 (-)

Description Similar to AHA8: ATPase 8, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80660`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At2g07560`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At3g42640`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0656100`	The plasma membrane ATPase of plants and fungi is a hydrogen ion pump.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032030 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008553 P-type proton-exporting transporter activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G80660

ath:AT2G07560

ath:AT3G42640

dosa:Os04g0656100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.694

Rank 1 · TkA03G408880 · TK1151

Endoplasmic reticulum0.136

Rank 2 · TkA03G408880 · TK1151

Cytoplasm0.094

Rank 3 · TkA03G408880 · TK1151

Lysosome / Vacuole0.083

Rank 4 · TkA03G408880 · TK1151

Golgi apparatus0.074

Rank 5 · TkA03G408880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690Cation_ATPase_N51-115 aa

PF00122E1-E2_ATPase165-263 aa

PF00702Hydrolase359-636 aa

PF13246Cation_ATPase419-527 aa

PF00122E1-E2_ATPase541-567 aa

PF08282Hydrolase_3622-656 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G408880	`PF00690`	Cation_ATPase_N	51	115	8.3e-14	51.7
TkA03G408880	`PF00122`	E1-E2_ATPase	165	263	2.1e-33	114.9
TkA03G408880	`PF00702`	Hydrolase	359	636	1.2e-11	46.0
TkA03G408880	`PF13246`	Cation_ATPase	419	527	1.7e-06	28.7
TkA03G408880	`PF00122`	E1-E2_ATPase	541	567	2.1e-33	114.9
TkA03G408880	`PF08282`	Hydrolase_3	622	656	0.0048	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42556`	Arabidopsis thaliana	sp\|Q42556\|PMA9_ARATH ATPase 9, plasma membrane-type	83.300%	Swiss-Prot	High
`Q9SH76`	Arabidopsis thaliana	sp\|Q9SH76\|PMA6_ARATH ATPase 6, plasma membrane-type	83.400%	Swiss-Prot	High
`Q9M2A0`	Arabidopsis thaliana	sp\|Q9M2A0\|PMA8_ARATH ATPase 8, plasma membrane-type	83.000%	Swiss-Prot	High
`Q7XPY2`	Oryza sativa subsp. japonica	sp\|Q7XPY2\|PMA1_ORYSJ Plasma membrane ATPase	82.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card