TkA03G405800 | RubberDandelionOmics

Gene overview

TkA03G405800

Reference: TK1151 Chr: Chr03 Coordinates: 100917167-100918899 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1075 bp · TkA03G405800|TK1151|cDNA

GCAAAACAAGCCAAAATAGAAAGAAAAAAAAGAAAAAGGAAGCTAAGAATTATAGGGAACTAGAGAGGGGATATGCATCAGTTTTCCCGTCATCTCAAAAAGCAACAAACTTCGATTAAGACAATGACAATCCCATCGTTTAATACCCCCATCTTTCTTCCATAATTTAATCCTCCTATCTTCATCACTGTTAAAGGTATCATCTCAATTTCCTCGGAATTCCAGAACCGATTGATACTTTGGAGGTTGAAGACATATGG...

CDS

Download CDS FASTA

528 bp · TkA03G405800|TK1151|CDS

ATGGGTAGTGCATCATCTACTCTAACTCAATATGATATCGAAGACGTTCAAGAACACTGTAATAATCTATTTTCCCAGCAAGAGATAGTCTCTTTATATCAAAGATTTTGCCAACTCGATCGAACTGCCAAGGGTTTTATTTCCGCCGAAGAGTTCTTATCAGTACCAGAATTTGCGGTGAATCCTCTGTCTCAGAGATTGCTTAAGATGGTGGATGGTTTGAACTTTAAGGACTTTGTGATATTCTTGTCGGCTTTTAG...

Protein

Download Protein FASTA

175 aa · TkA03G405800|TK1151|PROTEIN

MGSASSTLTQYDIEDVQEHCNNLFSQQEIVSLYQRFCQLDRTAKGFISAEEFLSVPEFAVNPLSQRLLKMVDGLNFKDFVIFLSAFSPKASMPQKIELIFKVYDSDYNGKVTFNDIMEVLRDLSGSFMSDKQREEVLIKVMQEAGYSKDSSLLVDDFVKILDHPGLKMEVEVPVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G405800`
TK1151 ID	TkA03G405800
OH-1004 ID	LXL04_009180
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G405800

Location Chr03:100917167-100918899 (+)

Description Similar to CNB1: Calcineurin subunit B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17615`	Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses.	A calcium sensor and its interacting protein kinase are global regulators of abscisic acid signaling in Arabidopsis.2002 · DOI: 10.1016/s1534-5807(02)00229-0 CBL1, a calcium sensor that differentially regulates salt, drought, and cold responses in Arabidopsis.2003 · DOI: 10.1105/tpc.012393 The calcium sensor CBL1 integrates plant responses to abiotic stresses.2003 · DOI: 10.1046/j.1365-313x.2003.01892.x A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x The Calcineurin B-like calcium sensors CBL1 and CBL9 together with their interacting protein kinase CIPK26 regulate the Arabidopsis NADPH oxidase RBOHF.2013 · DOI: 10.1093/mp/sst009 A novel role for Arabidopsis CBL1 in affecting plant responses to glucose and gibberellin during germination and seedling development.2013 · DOI: 10.1371/journal.pone.0056412

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009180 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006873 intracellular monoatomic ion homeostasis Biological Process

GO:0043157 response to cation stress Biological Process

GO:0071444 cellular response to pheromone Biological Process

GO:0071466 cellular response to xenobiotic stimulus Biological Process

GO:0071852 fungal-type cell wall organization or biogenesis Biological Process

GO:0097720 calcineurin-mediated signaling Biological Process

GO:0005955 calcineurin complex Cellular Component

GO:0004723 calcium-dependent protein serine/threonine phosphatase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity Molecular Function

GO:0019902 phosphatase binding Molecular Function

GO:0019903 protein phosphatase binding Molecular Function

KEGG gene cross-reference

ddi:DDB_G0267446

ddi:DDB_G0285999

ncr:NCU03833

ngr:NAEGRDRAFT_35722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA03G405800 · TK1151

Nucleus0.230

Rank 2 · TkA03G405800 · TK1151

Cell membrane0.186

Rank 3 · TkA03G405800 · TK1151

Golgi apparatus0.118

Rank 4 · TkA03G405800 · TK1151

Lysosome / Vacuole0.107

Rank 5 · TkA03G405800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22736NNH57-53 aa

PF08855DUF182511-45 aa

PF24082SPEF2_C25-55 aa

PF13499EF-hand_731-54 aa

PF13405EF-hand_632-55 aa

PF30624EF_SSP12034-53 aa

PF00036EF-hand_135-54 aa

PF13202EF-hand_536-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G405800	`PF22736`	NNH5	7	53	0.15	12.8
TkA03G405800	`PF08855`	DUF1825	11	45	0.16	12.7
TkA03G405800	`PF24082`	SPEF2_C	25	55	0.0062	17.0
TkA03G405800	`PF13499`	EF-hand_7	31	54	1.3e-10	42.2
TkA03G405800	`PF13405`	EF-hand_6	32	55	5.5e-10	38.8
TkA03G405800	`PF30624`	EF_SSP120	34	53	0.033	15.5
TkA03G405800	`PF00036`	EF-hand_1	35	54	6.8e-08	32.2
TkA03G405800	`PF13202`	EF-hand_5	36	54	0.00077	19.6
TkA03G405800	`PF13833`	EF-hand_8	43	53	0.0004	20.8
TkA03G405800	`PF26574`	GAIN_ADGRG2	51	77	0.0061	17.2
TkA03G405800	`PF24082`	SPEF2_C	59	116	0.0062	17.0
TkA03G405800	`PF05517`	p25-alpha	72	143	0.066	14.1
TkA03G405800	`PF00036`	EF-hand_1	74	85	6.8e-08	32.2
TkA03G405800	`PF13833`	EF-hand_8	74	83	0.0004	20.8
TkA03G405800	`PF11422`	IBP39	74	113	0.036	14.6
TkA03G405800	`PF13499`	EF-hand_7	94	160	1.3e-10	42.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81445`	Arabidopsis thaliana	sp\|O81445\|CNBL1_ARATH Calcineurin B-like protein 1	28.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card