TkA03G402480 | RubberDandelionOmics

Gene overview

TkA03G402480

Reference: TK1151 Chr: Chr03 Coordinates: 100098273-100101070 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2641 bp · TkA03G402480|TK1151|cDNA

CACAAGCACACACCAAAAAACAAATTCTTCTGCTTTTCTTGCCTTCAATCTTCTCTCAGTGATGCGATAGCTACCGGAGACCGACAAGATTTGATATTCCTCCTGCCGGAAAACGACTCCGACGATTTTTGCTCCTATCGTTGCTACTTTACCGGCGACTGTGATTCACCTGAGCGGCGGTGGCAGATGACTGCGGATGGCGACGATGGTTTCTGATCGGAGCACTAGTTCCGATTCTCACAGGTCAGCGACTTCCTTCT...

CDS

Download CDS FASTA

1227 bp · TkA03G402480|TK1151|CDS

ATGACAAACCAACAACCAGAGTCGCCGGCGGTGGACAATCAAACTGAACCGAAAGACCCTTATCACATTGCATACATAATCCACTTTCTCCTAGGCGCAGGGTATCTAGTTCCCTGGAATTCCTTCATCACTGCCGTCGACTACTTCCACCATCTTTATCCTTCACAGCACGTCAGCAAGGTATTCTCTGTTGCATACATGGCGGCGGCCACGACTGTCCTTGTTATTCTGATATGCTGGTCTAGTTTATTCAAGATGAG...

Protein

Download Protein FASTA

408 aa · TkA03G402480|TK1151|PROTEIN

MTNQQPESPAVDNQTEPKDPYHIAYIIHFLLGAGYLVPWNSFITAVDYFHHLYPSQHVSKVFSVAYMAAATTVLVILICWSSLFKMRLPALKARMNLGYGLFVLVLLVAQITDWVDQRNEFGRGSNFVFVVLVSMVAVTGFAEGLTAGSLIGATGKMPGRYMQAVVAGNASAGVLICMLRIITKASIPESRNGLRVSTRIYFVISTLIELLCILCFNFLHRIPTIQHYMTKTADIDDPPKTELRRPETLLVLKKLRWLVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G402480`
TK1151 ID	TkA03G402480
OH-1004 ID	LXL04_002006
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.400
Protein coverage (%)	TK1151 98.775 / OH-1004 97.805 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G402480

Location Chr03:100098273-100101070 (+)

Description Similar to ETN8: Equilibrative nucleotide transporter 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02630`	May be involved in nucleoside transport.	No verified direct reference in this release
`At1g70330`	Nucleoside transporter involved in adenosine transport and required for nucleotide metabolism which influences growth and pollen germination.	Characterisation of a concentrative type of adenosine transporter from Arabidopsis thaliana (ENT1,At).2001 · DOI: 10.1016/s0014-5793(01)03195-7 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 Equilibrative nucleoside transporter 1 (ENT1) is critical for pollen germination and vegetative growth in Arabidopsis.2011 · DOI: 10.1093/jxb/err183
`At4g05130`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At1g61630`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At3g09990`	May be involved in nucleoside transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002006 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015858 nucleoside transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005337 nucleoside transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G02630

ath:AT1G61630

ath:AT1G70330

ath:AT4G05120

ath:AT4G05130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.627

Rank 1 · TkA03G402480 · TK1151

Lysosome / Vacuole0.145

Rank 2 · TkA03G402480 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA03G402480 · TK1151

Cytoplasm0.110

Rank 4 · TkA03G402480 · TK1151

Golgi apparatus0.057

Rank 5 · TkA03G402480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15420Abhydrolase_9_N17-109 aa

PF01733Nucleoside_tran66-83 aa

PF16038TMIE69-95 aa

PF15420Abhydrolase_9_N96-186 aa

PF01733Nucleoside_tran134-407 aa

PF16038TMIE192-224 aa

PF16038TMIE255-271 aa

PF15420Abhydrolase_9_N384-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G402480	`PF15420`	Abhydrolase_9_N	17	109	4.0	8.1
TkA03G402480	`PF01733`	Nucleoside_tran	66	83	2.2e-62	211.9
TkA03G402480	`PF16038`	TMIE	69	95	9.8	6.8
TkA03G402480	`PF15420`	Abhydrolase_9_N	96	186	4.0	8.1
TkA03G402480	`PF01733`	Nucleoside_tran	134	407	2.2e-62	211.9
TkA03G402480	`PF16038`	TMIE	192	224	9.8	6.8
TkA03G402480	`PF16038`	TMIE	255	271	9.8	6.8
TkA03G402480	`PF15420`	Abhydrolase_9_N	384	407	4.0	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84XI3`	Arabidopsis thaliana	sp\|Q84XI3\|ENT8_ARATH Equilibrative nucleotide transporter 8	46.700%	Swiss-Prot	Medium
`Q8VXY7`	Arabidopsis thaliana	sp\|Q8VXY7\|ENT1_ARATH Equilibrative nucleotide transporter 1	45.500%	Swiss-Prot	Medium
`Q9M0Y2`	Arabidopsis thaliana	sp\|Q9M0Y2\|ENT4_ARATH Equilibrative nucleotide transporter 4	30.400%	Swiss-Prot	Medium
`Q944P0`	Arabidopsis thaliana	sp\|Q944P0\|ENT7_ARATH Equilibrative nucleotide transporter 7	29.700%	Swiss-Prot	Low
`Q9SR64`	Arabidopsis thaliana	sp\|Q9SR64\|ENT2_ARATH Equilibrative nucleotide transporter 2	30.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card