TkA03G394100 | RubberDandelionOmics

Gene overview

TkA03G394100

Reference: TK1151 Chr: Chr03 Coordinates: 97868288-97869529 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · TkA03G394100|TK1151|cDNA

CAAATCACATGAAGAGCTTTTAATATAAATGGCAAACCTCCTTCTTTCCCATCCTCCATCTTCCTCATCACTATTACTGCACGGACTTATTTTGATAAGATATGTCGGCGGCAAATCGTTACTTTTCCGGCAACGGCAAGCCACCTATGGAGAAATCGAAATTTGTGCAGACTTGCAACCGGCTGAGTCTATTTCTGAAGGAAAAAGGCAACCTCCGAGATCTTAGTTTCGGAATCAATGCAAAATTTGATTCTACAGGA...

CDS

Download CDS FASTA

714 bp · TkA03G394100|TK1151|CDS

ATGTCGGCGGCAAATCGTTACTTTTCCGGCAACGGCAAGCCACCTATGGAGAAATCGAAATTTGTGCAGACTTGCAACCGGCTGAGTCTATTTCTGAAGGAAAAAGGCAACCTCCGAGATCTTAGTTTCGGAATCAATGCAAAATTTGATTCTACAGGAATTTCGGAAACTTCTCCGGTGACTACTCCGGCGAAAAATACGACCGTTGATTTGTTAAGCAGCATGAATTATTCCGGTGAAAAGACCTTAAATTCGGAGAA...

Protein

Download Protein FASTA

237 aa · TkA03G394100|TK1151|PROTEIN

MSAANRYFSGNGKPPMEKSKFVQTCNRLSLFLKEKGNLRDLSFGINAKFDSTGISETSPVTTPAKNTTVDLLSSMNYSGEKTLNSEKSENIYPEYVILDSSCDVEDGKNKATSSSKAVTKPKTAQMTIFYGGNMMVLDDVPEDRVRSLMLMAQNDPPKIENRIELTSTSNDVFRSPQPIHVELQTKGSDLPIARRASLHKFLAKRKDRATVRAPYQVHHQSPGASSSGNKHRFDLNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G394100`
TK1151 ID	TkA03G394100
OH-1004 ID	LXL04_009035
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G394100

Location Chr03:97868288-97869529 (+)

Description Similar to TIFY10B: Protein TIFY 10B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74950`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g19180`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g72450`	Repressor of jasmonate responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0439200`	Repressor of jasmonate (JA) responses.	Involvement of OsJAZ8 in jasmonate-induced resistance to bacterial blight in rice.2012 · DOI: 10.1093/pcp/pcs145 Jasmonate induction of the monoterpene linalool confers resistance to rice bacterial blight and its biosynthesis is regulated by JAZ protein in rice.2014 · DOI: 10.1111/pce.12169

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009035 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900067 regulation of cellular response to alkaline pH Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G17380

ath:AT1G19180

ath:AT1G72450

ath:AT1G74950

gmx:100778559

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.941

Rank 1 · TkA03G394100 · TK1151

Cytoplasm0.120

Rank 2 · TkA03G394100 · TK1151

Cell membrane0.052

Rank 3 · TkA03G394100 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G394100 · TK1151

Plastid0.019

Rank 5 · TkA03G394100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200tify121-152 aa

PF09425Jas_motif191-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G394100	`PF06200`	tify	121	152	1.7e-14	53.6
TkA03G394100	`PF09425`	Jas_motif	191	216	1.4e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7M2`	Arabidopsis thaliana	sp\|Q9S7M2\|TI10B_ARATH Protein TIFY 10B	31.500%	Swiss-Prot	Medium
`Q9LMA8`	Arabidopsis thaliana	sp\|Q9LMA8\|TI10A_ARATH Protein TIFY 10A	32.300%	Swiss-Prot	Medium
`Q9C9E3`	Arabidopsis thaliana	sp\|Q9C9E3\|TI11B_ARATH Protein TIFY 11B	30.400%	Swiss-Prot	Medium
`Q69P94`	Oryza sativa subsp. japonica	sp\|Q69P94\|TI10C_ORYSJ Protein TIFY 10c	29.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card