TkA03G393890 | RubberDandelionOmics

Gene overview

TkA03G393890

Reference: TK1151 Chr: Chr03 Coordinates: 97783403-97784914 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · TkA03G393890|TK1151|cDNA

ATGTCATCGGTTCACTTGAATCCTAGAACCAGCACCCGTATTAGCTACTTTCCGACGGACGACGATTACAGCAGCAGAGGCGACGAAGACTCTATATCCAGAGACGATTCTTCTTCCCAATCGGAACGAGGCGAGAGTAGCAACATAAGTAGTATTCGAGAGATAGATCTGTATCCTTCGGATATCGTATGTGATCTTCGCAGCATCGCGAAGCGTATGATTGCCGCGGGCTACTTCAGGTTGTGCGTTCAGATGTACAG...

CDS

Download CDS FASTA

870 bp · TkA03G393890|TK1151|CDS

ATGTCATCGGTTCACTTGAATCCTAGAACCAGCACCCGTATTAGCTACTTTCCGACGGACGACGATTACAGCAGCAGAGGCGACGAAGACTCTATATCCAGAGACGATTCTTCTTCCCAATCGGAACGAGGCGAGAGTAGCAACATAAGTAGTATTCGAGAGATAGATCTGTATCCTTCGGATATCGTATGTGATCTTCGCAGCATCGCGAAGCGTATGATTGCCGCGGGCTACTTCAGGTTGTGCGTTCAGATGTACAG...

Protein

Download Protein FASTA

289 aa · TkA03G393890|TK1151|PROTEIN

MSSVHLNPRTSTRISYFPTDDDYSSRGDEDSISRDDSSSQSERGESSNISSIREIDLYPSDIVCDLRSIAKRMIAAGYFRLCVQMYSSVRKSAVDACFKKLGVEKLSIGDIESVFDGKASESIRIQVTEILSRLAEPGRVMINEFEENVVLREPSRVTVPGGTIHPLTRYVMDYISFISDYKQTLENVIVSRPATGSQYSNDPSTPDMDFTDLEEQSPFALHLIWIIAILKFNLEENSKHYKDNSLAQIFIMNNLHYIVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G393890`
TK1151 ID	TkA03G393890
OH-1004 ID	LXL04_009028
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.800
Protein coverage (%)	TK1151 95.156 / OH-1004 62.081 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G393890

Location Chr03:97783403-97784914 (-)

Description Similar to EXO70B1: Exocyst complex component EXO70B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13990`	Required for optimal tip growth of pollen tube.	EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282 Regulation of Exocyst Function in Pollen Tube Growth by Phosphorylation of Exocyst Subunit EXO70C2.2020 · DOI: 10.3389/fpls.2020.609600
`At5g58430`	Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.	Arabidopsis exocyst subcomplex containing subunit EXO70B1 is involved in autophagy-related transport to the vacuole.2013 · DOI: 10.1111/tra.12101 The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347
`At5g13150`	Required for global plant growth and for male transmission.	Expression and functional analyses of EXO70 genes in Arabidopsis implicate their roles in regulating cell type-specific exocytosis.2010 · DOI: 10.1104/pp.110.164178 EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282
`At1g07000`	Component of an exocyst subcomplex specifically involved in autophagy-related, Golgi-independent membrane traffic to the vacuole.	The role for the exocyst complex subunits Exo70B2 and Exo70H1 in the plant-pathogen interaction.2011 · DOI: 10.1093/jxb/erq402 The ubiquitin ligase PUB22 targets a subunit of the exocyst complex required for PAMP-triggered responses in Arabidopsis.2012 · DOI: 10.1105/tpc.112.104463 The N-Terminal UND Motif of the Arabidopsis U-Box E3 Ligase PUB18 Is Critical for the Negative Regulation of ABA-Mediated Stomatal Movement and Determines Its Ubiquitination Specificity for Exocyst Subunit Exo70B1.2016 · DOI: 10.1105/tpc.16.00347
`At5g52350`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006887 exocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0006955 immune response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010089 xylem development Biological Process

KEGG gene cross-reference

ath:AT1G07000

ath:AT5G03540

ath:AT5G13150

ath:AT5G13990

ath:AT5G58430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA03G393890 · TK1151

Nucleus0.321

Rank 2 · TkA03G393890 · TK1151

Cell membrane0.311

Rank 3 · TkA03G393890 · TK1151

Lysosome / Vacuole0.066

Rank 4 · TkA03G393890 · TK1151

Golgi apparatus0.049

Rank 5 · TkA03G393890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03081Exo70_C109-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G393890	`PF03081`	Exo70_C	109	278	2.6e-46	159.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFX6`	Arabidopsis thaliana	sp\|Q9FFX6\|E70C2_ARATH Exocyst complex component EXO70C2	36.100%	Swiss-Prot	Medium
`Q9FGH9`	Arabidopsis thaliana	sp\|Q9FGH9\|E70B1_ARATH Exocyst complex component EXO70B1	38.600%	Swiss-Prot	Medium
`Q9FY95`	Arabidopsis thaliana	sp\|Q9FY95\|E70C1_ARATH Exocyst complex component EXO70C1	38.100%	Swiss-Prot	Low
`Q9LMJ4`	Arabidopsis thaliana	sp\|Q9LMJ4\|E70B2_ARATH Exocyst complex component EXO70B2	33.300%	Swiss-Prot	Medium
`F4KG58`	Arabidopsis thaliana	sp\|F4KG58\|E70A3_ARATH Exocyst complex component EXO70A3	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card