TkA03G389990 | RubberDandelionOmics

Gene overview

TkA03G389990

Reference: TK1151 Chr: Chr03 Coordinates: 96634746-96637396 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1925 bp · TkA03G389990|TK1151|cDNA

CAAACATTTAACTTGGTCAACCTAAAACTTTAGTTTCGAAACCCCCACCAATGTTCATTCTGAAATTTTATAAATAACACCACACACCTGGTATAATGTACAAGAAACGCATCTAACTTCCACTTAAAACATGTTGAATTGATGCATCAAGAAACGATGGTTCCTCTGGTTTACGCTACACCATTGTTACTCCTAGTCTTCTTTCTCATCAACTTCTATTACTTTACTCGACCCTCCGCCAAGGTAAACCTACCACCTTC...

CDS

Download CDS FASTA

1530 bp · TkA03G389990|TK1151|CDS

ATGCATCAAGAAACGATGGTTCCTCTGGTTTACGCTACACCATTGTTACTCCTAGTCTTCTTTCTCATCAACTTCTATTACTTTACTCGACCCTCCGCCAAGGTAAACCTACCACCTTCGCCACCAAAACTGCCGGTGATCGGCAACATCCACCAATTAGGACCAATCCTCCACCGCTCCCTCCACAATTTATCCCACCGCTACGGTGGTCCATTGATGCTCATGCACTTGGGCTCCGTCCCAACCCTTGTGATCTCATC...

Protein

Download Protein FASTA

509 aa · TkA03G389990|TK1151|PROTEIN

MHQETMVPLVYATPLLLLVFFLINFYYFTRPSAKVNLPPSPPKLPVIGNIHQLGPILHRSLHNLSHRYGGPLMLMHLGSVPTLVISSAEAAREIMKTQDLNFATRPDVRRWHQILYDQKEVSVAPYGEEWRQFKSIMVLHFLSKSKVEAYRKVREEETAIAVEKIEKSCDLQEAVNLSEMFSKLTNDVVCRVTFGKKYSEGENERKFNKMLKEYFDVLSELNFEDMIPWLWWVDRLRGTAARVEKVAKDVDEFLDGLVEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G389990`
TK1151 ID	TkA03G389990
OH-1004 ID	LXL04_008256
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G389990`
Location	Chr03:96634746-96637396 (+)
Description	Similar to CYP736A117: Cytochrome P450 736A117
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008256` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016114 terpenoid biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0020037 heme binding Molecular Function GO:0102627 parthenolide 3beta-hydroxylase activity Molecular Function GO:0102628 costunolide 3beta-hydroxylase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.934

Rank 1 · TkA03G389990 · TK1151

Cell membrane0.041

Rank 2 · TkA03G389990 · TK1151

Cytoplasm0.035

Rank 3 · TkA03G389990 · TK1151

Golgi apparatus0.026

Rank 4 · TkA03G389990 · TK1151

Plastid0.025

Rank 5 · TkA03G389990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45038-497 aa

PF08766DEK_C92-110 aa

PF15813DUF4708107-164 aa

PF20105DUF6495137-208 aa

PF28950YDR249C_C203-235 aa

PF28950YDR249C_C314-367 aa

PF20105DUF6495333-363 aa

PF08766DEK_C335-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G389990	`PF00067`	p450	38	497	2.5e-116	389.9
TkA03G389990	`PF08766`	DEK_C	92	110	0.1	13.3
TkA03G389990	`PF15813`	DUF4708	107	164	0.13	12.3
TkA03G389990	`PF20105`	DUF6495	137	208	0.36	11.6
TkA03G389990	`PF28950`	YDR249C_C	203	235	0.05	14.1
TkA03G389990	`PF28950`	YDR249C_C	314	367	0.05	14.1
TkA03G389990	`PF20105`	DUF6495	333	363	0.36	11.6
TkA03G389990	`PF08766`	DEK_C	335	350	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card