TkA03G389150 | RubberDandelionOmics

Gene overview

TkA03G389150

Reference: TK1151 Chr: Chr03 Coordinates: 96378472-96380183 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · TkA03G389150|TK1151|cDNA

CTGGAAGACGAGTTCATTATAAAGGTCAAAGATGCTGTTGGGCATATACTGAGTTGGCCAACAGATCTAGTCATCCGATGCTGTGATCTGGCAAAGTTAACAAGGATGCCAAAGATAAAAAGTCAAAAACATGCAAAGGAAGATGAATACGAAAGTAGGAAAGAAACAGAACGAAAAAAATTGGAAAATAGAAATAGTTTAGAAAAAGAAAAAGAAAAACTGGAAAAGGAGAAACAAAAAGAAAATGATAAAAAAGAAAA...

CDS

Download CDS FASTA

858 bp · TkA03G389150|TK1151|CDS

CTGGAAGACGAGTTCATTATAAAGGTCAAAGATGCTGTTGGGCATATACTGAGTTGGCCAACAGATCTAGTCATCCGATGCTGTGATCTGGCAAAGTTAACAAGGATGCCAAAGATAAAAAGTCAAAAACATGCAAAGGAAGATGAATACGAAAGTAGGAAAGAAACAGAACGAAAAAAATTGGAAAATAGAAATAGTTTAGAAAAAGAAAAAGAAAAACTGGAAAAGGAGAAACAAAAAGAAAATGATAAAAAAGAAAA...

Protein

Download Protein FASTA

285 aa · TkA03G389150|TK1151|PROTEIN

LEDEFIIKVKDAVGHILSWPTDLVIRCCDLAKLTRMPKIKSQKHAKEDEYESRKETERKKLENRNSLEKEKEKLEKEKQKENDKKEKVKGKKITIQNEAPITPRRRTRGQIGKNVRVECSRVLKMTEKLVSSKGSKQLATKVQCEDDLFGYESLTYITWEDFQVIFTLDELTGSIITCYMMYLYEQVKNGCDKDHGVCFVSPSAISGDGRKEKFVKGDDASRSIATRLSTRKNNNLVLLPYNPGRHWVLVVLDMDTTTCY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G389150`
TK1151 ID	TkA03G389150
OH-1004 ID	LXL04_028556
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.500
Protein coverage (%)	TK1151 100.000 / OH-1004 14.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G389150`
Location	Chr03:96378472-96380183 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028556` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · TkA03G389150 · TK1151

Cytoplasm0.137

Rank 2 · TkA03G389150 · TK1151

Cell membrane0.018

Rank 3 · TkA03G389150 · TK1151

Mitochondrion0.018

Rank 4 · TkA03G389150 · TK1151

Extracellular0.014

Rank 5 · TkA03G389150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17110TFB624-85 aa

PF02724CDC4532-110 aa

PF02932Neur_chan_memb33-116 aa

PF05132RNA_pol_Rpc436-113 aa

PF22770POP1_C38-121 aa

PF02902Peptidase_C4867-67 aa

PF02902Peptidase_C48172-267 aa

PF02724CDC45253-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G389150	`PF17110`	TFB6	24	85	0.061	13.8
TkA03G389150	`PF02724`	CDC45	32	110	1.6	7.6
TkA03G389150	`PF02932`	Neur_chan_memb	33	116	6.6	7.6
TkA03G389150	`PF05132`	RNA_pol_Rpc4	36	113	6.3	7.7
TkA03G389150	`PF22770`	POP1_C	38	121	4.6	8.2
TkA03G389150	`PF02902`	Peptidase_C48	67	67	0.0077	16.8
TkA03G389150	`PF02902`	Peptidase_C48	172	267	0.0077	16.8
TkA03G389150	`PF02724`	CDC45	253	274	1.6	7.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card