TkA03G387750 | RubberDandelionOmics

Gene overview

TkA03G387750

Reference: TK1151 Chr: Chr03 Coordinates: 95963259-95968525 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2877 bp · TkA03G387750|TK1151|cDNA

ATTACTTCTCTCGAAAGAAAATCTTGAATATCATGAGACAGTGGTGTGACGCCCACCTTTCAAGAAGACCAAGAACACAAAGAGGGGGATTTATACTTGCCTGAGATCGCACGCTGTTTGCTTCTTCTTCTTCCTCTTCTTATTTCAAAAAGCAAAGATCAAATCCCACTTCTAAGTGTTCTTCATGGATAGAGAAGCTGAATGTTGCTCCACTCACCTGATAGATGGGGATGGTACTTTCAATGCAGTTGGACTTGATA...

CDS

Download CDS FASTA

2118 bp · TkA03G387750|TK1151|CDS

ATGGATCTTGAGGGTACTGATGGAAGAGAGCGAGGAGAGGATGATACCGCATTTGAGAAACAGAGTGCCCTTTTTGCCCTTGCAGTTTCAGATATTGTGCTTATAAACATGTGGTGTCATGATATTGGACGTGAACAGGCTGCAAATAAACCTCTTCTGAAAACCGTATTCCAGGTTATGTTGCGATTGTTTAGTCCACGTAAAACAACTTTAATGTTTGTCATCCGTGATAAAACAAGGACACCTCTTGAAAACCTAGA...

Protein

Download Protein FASTA

705 aa · TkA03G387750|TK1151|PROTEIN

MDLEGTDGRERGEDDTAFEKQSALFALAVSDIVLINMWCHDIGREQAANKPLLKTVFQVMLRLFSPRKTTLMFVIRDKTRTPLENLEPVLREDIQKIWDTVSKPEAHKHTPLSEFFNVQVVALSSYEEKEEQFKEQVATLRQKFFHSIAPGGLAGDRRGVVPASGFSFSAQQIWKVIKENKDLDLPAHKVMVATVRCEEIANEKYSSFITNEDWIELEEAVQTNHVPGFGKKLSSLITKCLSSYDEEATYFEDSVRSAKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G387750`
TK1151 ID	TkA03G387750
OH-1004 ID	LXL04_036790
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.300
Protein coverage (%)	TK1151 94.468 / OH-1004 86.770 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G387750

Location Chr03:95963259-95968525 (+)

Description Similar to RHD3: Protein ROOT HAIR DEFECTIVE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13870`	Probable GTP-binding protein involved in cell wall expansion.	Regulation of the cell expansion gene RHD3 during Arabidopsis development.2002 · DOI: 10.1104/pp.002675 The Arabidopsis RHD3 gene is required for cell wall biosynthesis and actin organization.2003 · DOI: 10.1007/s00425-003-1067-7 A GFP-based assay reveals a role for RHD3 in transport between the endoplasmic reticulum and Golgi apparatus.2004 · DOI: 10.1046/j.1365-313x.2003.01969.x Loss-of-function mutations of ROOT HAIR DEFECTIVE3 suppress root waving, skewing, and epidermal cell file rotation in Arabidopsis.2005 · DOI: 10.1104/pp.105.059774 Growth and ultrastructure of Arabidopsis root hairs: the rhd3 mutation alters vacuole enlargement and tip growth.1997 · DOI: 10.1007/bf01007706 The ROOT HAIR DEFECTIVE3 gene encodes an evolutionarily conserved protein with GTP-binding motifs and is required for regulated cell enlargement in Arabidopsis.1997 · DOI: 10.1101/gad.11.6.799
`At1g72960`	Probable GTP-binding protein that may be involved in cell development.	No verified direct reference in this release
`At5g45160`	Probable GTP-binding protein that may be involved in cell development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0575000`	Probable GTP-binding protein that may be involved in cell development.	No verified direct reference in this release
`Os12g0604600`	Probable GTP-binding protein that may be involved in cell development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036790 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0016320 endoplasmic reticulum membrane fusion Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G72960

ath:AT3G13870

ath:AT5G45160

dosa:Os01g0575000

dosa:Os12g0604600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.572

Rank 1 · TkA03G387750 · TK1151

Golgi apparatus0.220

Rank 2 · TkA03G387750 · TK1151

Cytoplasm0.158

Rank 3 · TkA03G387750 · TK1151

Nucleus0.138

Rank 4 · TkA03G387750 · TK1151

Mitochondrion0.092

Rank 5 · TkA03G387750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05879RHD3_GTPase1-186 aa

PF14591AF0941-like84-143 aa

PF20428Sey1_3HB95-142 aa

PF10922T7-like_gp12216-246 aa

PF20428Sey1_3HB228-659 aa

PF10922T7-like_gp12281-316 aa

PF14591AF0941-like392-434 aa

PF10922T7-like_gp12411-452 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G387750	`PF05879`	RHD3_GTPase	1	186	2.1e-89	299.9
TkA03G387750	`PF14591`	AF0941-like	84	143	0.13	13.6
TkA03G387750	`PF20428`	Sey1_3HB	95	142	1.5e-136	456.3
TkA03G387750	`PF10922`	T7-like_gp12	216	246	0.1	13.5
TkA03G387750	`PF20428`	Sey1_3HB	228	659	1.5e-136	456.3
TkA03G387750	`PF10922`	T7-like_gp12	281	316	0.1	13.5
TkA03G387750	`PF14591`	AF0941-like	392	434	0.13	13.6
TkA03G387750	`PF10922`	T7-like_gp12	411	452	0.1	13.5
TkA03G387750	`PF14591`	AF0941-like	477	504	0.13	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93042`	Arabidopsis thaliana	sp\|P93042\|RHD3_ARATH Protein ROOT HAIR DEFECTIVE 3	71.100%	Swiss-Prot	High
`Q9SSN0`	Arabidopsis thaliana	sp\|Q9SSN0\|RHD31_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 1	70.600%	Swiss-Prot	High
`Q9FKE9`	Arabidopsis thaliana	sp\|Q9FKE9\|RHD32_ARATH Protein ROOT HAIR DEFECTIVE 3 homolog 2	65.400%	Swiss-Prot	High
`Q0JLS6`	Oryza sativa subsp. japonica	sp\|Q0JLS6\|RHD3_ORYSJ Protein ROOT HAIR DEFECTIVE 3	67.300%	Swiss-Prot	High
`Q2QMH2`	Oryza sativa subsp. japonica	sp\|Q2QMH2\|RHD31_ORYSJ Protein ROOT HAIR DEFECTIVE 3 homolog 1	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card