TkA03G385300 | RubberDandelionOmics

Gene overview

TkA03G385300

Reference: TK1151 Chr: Chr03 Coordinates: 95333934-95334911 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · TkA03G385300|TK1151|cDNA

ATGGAATCAGTGCAAAATGACATCATTTTGGTAGAGAAAGTTTGTGAGATTTATCACAAAATTTCAAAGCTTGACACCCTCAAACCTTCCGAAGATGTTAATACCCTTTTCACAGAACTAGTCAGCACGTGCATCCCACCCGCTTCTATCAACATAGCCAATCTCCCGAGTGATGTTCAAGAAATAAGGTCAAAGCTCATAAGACTTTGTGGCGAGGCTGAAGGCCATCTTGAAGCACACTTCTCCACTATATTAGGCTC...

CDS

Download CDS FASTA

978 bp · TkA03G385300|TK1151|CDS

ATGGAATCAGTGCAAAATGACATCATTTTGGTAGAGAAAGTTTGTGAGATTTATCACAAAATTTCAAAGCTTGACACCCTCAAACCTTCCGAAGATGTTAATACCCTTTTCACAGAACTAGTCAGCACGTGCATCCCACCCGCTTCTATCAACATAGCCAATCTCCCGAGTGATGTTCAAGAAATAAGGTCAAAGCTCATAAGACTTTGTGGCGAGGCTGAAGGCCATCTTGAAGCACACTTCTCCACTATATTAGGCTC...

Protein

Download Protein FASTA

325 aa · TkA03G385300|TK1151|PROTEIN

MESVQNDIILVEKVCEIYHKISKLDTLKPSEDVNTLFTELVSTCIPPASINIANLPSDVQEIRSKLIRLCGEAEGHLEAHFSTILGSFPHPLHHLNEFPYYSNYLKLGRLEFDILTKHYSTSKQAPKRLAFVGSGPLPLTSIVLASYHLNDTIFHNYDIDSLANSMASHLVSSDPDLSQRMVFHTTNIMDVKDELKEYDVVFLAALVGMDIDEKVKVIDHLAKYMAPSALLMLRSAHGARVFLYPVVDVHLLKGFEVLDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G385300`
TK1151 ID	TkA03G385300
OH-1004 ID	LXL04_008325
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G385300

Location Chr03:95333934-95334911 (-)

Description Similar to NAS4: Probable nicotianamine synthase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56430`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At1g09240`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At5g04950`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At5g56080`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010233 phloem transport Biological Process

GO:0030418 nicotianamine biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0030410 nicotianamine synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09240

ath:AT1G56430

ath:AT5G04950

ath:AT5G56080

sly:101248619

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA03G385300 · TK1151

Nucleus0.357

Rank 2 · TkA03G385300 · TK1151

Mitochondrion0.069

Rank 3 · TkA03G385300 · TK1151

Peroxisome0.069

Rank 4 · TkA03G385300 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA03G385300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03059NAS8-278 aa

PF01739CheR174-233 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G385300	`PF03059`	NAS	8	278	1.2e-124	415.9
TkA03G385300	`PF01739`	CheR	174	233	0.019	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7X5`	Arabidopsis thaliana	sp\|Q9C7X5\|NAS4_ARATH Probable nicotianamine synthase 4	63.400%	Swiss-Prot	High
`O80483`	Arabidopsis thaliana	sp\|O80483\|NAS3_ARATH Nicotianamine synthase 3	66.900%	Swiss-Prot	High
`Q9FF79`	Arabidopsis thaliana	sp\|Q9FF79\|NAS1_ARATH Nicotianamine synthase 1	55.600%	Swiss-Prot	High
`Q9FKT9`	Arabidopsis thaliana	sp\|Q9FKT9\|NAS2_ARATH Nicotianamine synthase 2	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card