TkA03G383130 | RubberDandelionOmics

Gene overview

TkA03G383130

Reference: TK1151 Chr: Chr03 Coordinates: 94605682-94609944 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · TkA03G383130|TK1151|cDNA

ACCGAACTCTTATTGACGCTCTTTCTCGAATCTCCTAAAGATTTTCTTTCTACGTTGGTCTCTCGGTTATCGTTGCCCTTTCCTCCAAGCAAACACCACAAGACACACCTCACTTTTTCTCCCGCTCGATCGTGCGAACAACAGAAGCTCCTCGAAATTATGCCGACAGTGAGTGTGAAATGGCAAAAGGAGCTATACCCTGCAGTGGAGATAGATACAACCCAGCCTCCATTTGTCTTTAAATGTCAGTTGTATGAGCT...

CDS

Download CDS FASTA

753 bp · TkA03G383130|TK1151|CDS

ACCGAACTCTTATTGACGCTCTTTCTCGAATCTCCTAAAGATTTTCTTTCTACGTTGGTCTCTCGGTTATCGTTGCCCTTTCCTCCAAGCAAACACCACAAGACACACCTCACTTTTTCTCCCGCTCGATCGTGCGAACAACAGAAGCTCCTCGAAATTATGCCGACAGTGAGTGTGAAATGGCAAAAGGAGCTATACCCTGCAGTGGAGATAGATACAACCCAGCCTCCATTTGTCTTTAAATGTCAGTTGTATGAGCT...

Protein

Download Protein FASTA

250 aa · TkA03G383130|TK1151|PROTEIN

TELLLTLFLESPKDFLSTLVSRLSLPFPPSKHHKTHLTFSPARSCEQQKLLEIMPTVSVKWQKELYPAVEIDTTQPPFVFKCQLYELTGVPPERQKIMMKGGLLKDDSDWSKLGVKEGQKLMMMGTADEIIKAPEKGPVFMEDLPEEEQVVAVGHSAGLFNLGNTCYMNSTMQCLHSVPELKSALIEYPQSGRSNDLDQSSHLLTVATRDLFGELDKNVKPVAPMQFWMVLRKKYPQFGQLHNGSFATGC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G383130`
TK1151 ID	TkA03G383130
OH-1004 ID	LXL04_008319
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 96.800 / OH-1004 45.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G383130

Location Chr03:94605682-94609944 (+)

Description Similar to UBP6: Ubiquitin carboxyl-terminal hydrolase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21280`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At1g51710`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016579 protein deubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0050920 regulation of chemotaxis Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:1904293 negative regulation of ERAD pathway Biological Process

GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G51710

ath:AT3G21280

bta:505106

hsa:9097

mmu:59025

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.645

Rank 1 · TkA03G383130 · TK1151

Nucleus0.394

Rank 2 · TkA03G383130 · TK1151

Mitochondrion0.104

Rank 3 · TkA03G383130 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA03G383130 · TK1151

Cell membrane0.079

Rank 5 · TkA03G383130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin61-126 aa

PF13423UCH_1157-186 aa

PF00443UCH158-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G383130	`PF00240`	ubiquitin	61	126	4.3e-08	33.5
TkA03G383130	`PF13423`	UCH_1	157	186	0.17	12.2
TkA03G383130	`PF00443`	UCH	158	239	7.1e-16	59.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WC6`	Arabidopsis thaliana	sp\|Q84WC6\|UBP7_ARATH Ubiquitin carboxyl-terminal hydrolase 7	77.600%	Swiss-Prot	High
`Q949Y0`	Arabidopsis thaliana	sp\|Q949Y0\|UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6	73.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card