TkA03G383110 | RubberDandelionOmics

Gene overview

TkA03G383110

Reference: TK1151 Chr: Chr03 Coordinates: 94593768-94594175 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

408 bp · TkA03G383110|TK1151|cDNA

ATGGAAATGAGTGTTTTGAGCTTCAACCTACCGTTATCCTTCGGATCTGTTCAAGGACTTGATGCTAAGACGATCTATACTCCGATCTGCTATACGACGAGAGCAACAAGATGTCAGAGGGCTTCAGTTATTGCGAACGGGATAGGAGGAGGATCGGCCAAGTACAAAGGAACACAGATGAGAGAGAAAAAGCTGACGGAGTTGATCGAGTCAAAAATCGCTGAAGCTACGCAAGTTTGTGAGGGGGATCGTGACTCCGA...

CDS

Download CDS FASTA

408 bp · TkA03G383110|TK1151|CDS

ATGGAAATGAGTGTTTTGAGCTTCAACCTACCGTTATCCTTCGGATCTGTTCAAGGACTTGATGCTAAGACGATCTATACTCCGATCTGCTATACGACGAGAGCAACAAGATGTCAGAGGGCTTCAGTTATTGCGAACGGGATAGGAGGAGGATCGGCCAAGTACAAAGGAACACAGATGAGAGAGAAAAAGCTGACGGAGTTGATCGAGTCAAAAATCGCTGAAGCTACGCAAGTTTGTGAGGGGGATCGTGACTCCGA...

Protein

Download Protein FASTA

135 aa · TkA03G383110|TK1151|PROTEIN

MEMSVLSFNLPLSFGSVQGLDAKTIYTPICYTTRATRCQRASVIANGIGGGSAKYKGTQMREKKLTELIESKIAEATQVCEGDRDSDECKVAWDEVEEVSQAKADLRRKLDENKDPLQSFCEENPETDECRIYED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G383110`
TK1151 ID	TkA03G383110
OH-1004 ID	LXL04_008321
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 96.296 / OH-1004 67.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G383110

Location Chr03:94593768-94594175 (-)

Description Similar to CP12-3: Calvin cycle protein CP12-3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76560`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008
`At3g62410`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008
`At2g47400`	Acts as a linker essential in the assembly of a core complex of PRK/GAPDH.	In vitro characterization of Arabidopsis CP12 isoforms reveals common biochemical and molecular properties.2010 · DOI: 10.1016/j.jplph.2010.02.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008321 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009744 response to sucrose Biological Process

GO:0018316 peptide cross-linking via L-cystine Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071454 cellular response to anoxia Biological Process

GO:0080153 negative regulation of reductive pentose-phosphate cycle Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G76560

ath:AT2G47400

ath:AT3G62410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA03G383110 · TK1151

Mitochondrion0.029

Rank 2 · TkA03G383110 · TK1151

Cytoplasm0.018

Rank 3 · TkA03G383110 · TK1151

Nucleus0.016

Rank 4 · TkA03G383110 · TK1151

Cell membrane0.009

Rank 5 · TkA03G383110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06404PSK45-89 aa

PF26829ValRS_modifier55-90 aa

PF02672CP1265-134 aa

PF06404PSK104-130 aa

PF26829ValRS_modifier105-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G383110	`PF06404`	PSK	45	89	3.7	9.4
TkA03G383110	`PF26829`	ValRS_modifier	55	90	0.34	11.6
TkA03G383110	`PF02672`	CP12	65	134	3.5e-24	86.0
TkA03G383110	`PF06404`	PSK	104	130	3.7	9.4
TkA03G383110	`PF26829`	ValRS_modifier	105	134	0.34	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9K2`	Arabidopsis thaliana	sp\|Q9C9K2\|CP123_ARATH Calvin cycle protein CP12-3, chloroplastic	71.800%	Swiss-Prot	Medium
`Q9LZP9`	Arabidopsis thaliana	sp\|Q9LZP9\|CP122_ARATH Calvin cycle protein CP12-2, chloroplastic	45.900%	Swiss-Prot	Medium
`O22914`	Arabidopsis thaliana	sp\|O22914\|CP121_ARATH Calvin cycle protein CP12-1, chloroplastic	47.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card