TkA03G381170 | RubberDandelionOmics

Gene overview

TkA03G381170

Reference: TK1151 Chr: Chr03 Coordinates: 94006911-94008490 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1387 bp · TkA03G381170|TK1151|cDNA

CAAATATATATAATCAGAAGAACAATTAAAAAACACAAAAAAACAATGGCTACGGTTTACAGTTCCATCTTCTCTTCCAACTTCATCTATCTTCAACCTTCAACAAACCCCATCACTAAAATCACCTCTCACCCCCTCTCTAATCTCACTCTATCTCACAATAACTTCAATGCCTCCACAAGAAATTTCCGATTGCCAAGAGCCGCTTCGATTCCACACCCACCGATTAACGTCGATTACCTCGAAACAGAATTCAGCGG...

CDS

Download CDS FASTA

798 bp · TkA03G381170|TK1151|CDS

ATGCCTCCACAAGAAATTTCCGATTGCCAAGAGCCGCTTCGATTCCACACCCACCGATTAACGTCGATTACCTCGAAACAGAATTCAGCGGCCATGGCACTTCCTTCACAAGACTCGGCGAAAGCTGCGTTCAGAATGGGACTTGACAACGGTAGTGTAGCCACTCTCATGCTTCCAAGCGGGCTGATTACGTCCTACAAAGCGTGTATGTGGCATGGAGGATTACTGGAGTTGCTGCACACGCAGGTGTCAGAGGACGA...

Protein

Download Protein FASTA

265 aa · TkA03G381170|TK1151|PROTEIN

MPPQEISDCQEPLRFHTHRLTSITSKQNSAAMALPSQDSAKAAFRMGLDNGSVATLMLPSGLITSYKACMWHGGLLELLHTQVSEDDGRGAVIRGGVSLAFRCEGAGHDSENGGIPWSPSIWNLRNVGGSPDESIQVELISTSLEDKIEIKHIVTLKQDTLTSEIVIANLRSSSLQLMGSVIGHLAVSTPEASYAVGLERANYFVKPQIFSNFSIIPPDLNQNDSRQSGFMQLLSGWGLGTPIKPQKTTKKMKKWKVKRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G381170`
TK1151 ID	TkA03G381170
OH-1004 ID	LXL04_004763
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 77.736 / OH-1004 51.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G381170

Location Chr03:94006911-94008490 (-)

Description Similar to NDF5: Protein NDH-DEPENDENT CYCLIC ELECTRON FLOW 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55370`	Required for both formation and activity of the chloroplast NAD(P)H dehydrogenase (NDH) complex of the photosynthetic electron transport chain.	A novel nuclear-encoded protein, NDH-dependent cyclic electron flow 5, is essential for the accumulation of chloroplast NAD(P)H dehydrogenase complexes.2009 · DOI: 10.1093/pcp/pcn205

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone) Cellular Component

GO:0016020 membrane Cellular Component

GO:0030246 carbohydrate binding Molecular Function

GO:0047938 glucose-6-phosphate 1-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55370

ath:AT1G64770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.882

Rank 1 · TkA03G381170 · TK1151

Cytoplasm0.102

Rank 2 · TkA03G381170 · TK1151

Nucleus0.076

Rank 3 · TkA03G381170 · TK1151

Mitochondrion0.049

Rank 4 · TkA03G381170 · TK1151

Peroxisome0.046

Rank 5 · TkA03G381170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C503`	Arabidopsis thaliana	sp\|Q9C503\|NDF5_ARATH Protein NDH-DEPENDENT CYCLIC ELECTRON FLOW 5	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card