TkA03G379200 | RubberDandelionOmics

Gene overview

TkA03G379200

Reference: TK1151 Chr: Chr03 Coordinates: 93522628-93523111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA03G379200|TK1151|cDNA

ATGATAATGTCTATAATTTGGAAGCGCGTTAATGATACTGGAAAAAACTGGCGCCATGTGTACAAGGGTTTGACCGTTCTTGAATACTTGGTAGCAAACGGGTCAGAACGTGTCATCGATGAAATTAAAGAACATTCCTACCAGATAACAACATTGTCAGAGTTTGAATATATTGATCGTACTGGGAGGGATCAAGGGAACAATGTAAGAAAGAAGTCGCAAAGTCTTGTGGCTTTAGTCAATGACAAAGAAAAGATACA...

CDS

Download CDS FASTA

324 bp · TkA03G379200|TK1151|CDS

ATGATAATGTCTATAATTTGGAAGCGCGTTAATGATACTGGAAAAAACTGGCGCCATGTGTACAAGGGTTTGACCGTTCTTGAATACTTGGTAGCAAACGGGTCAGAACGTGTCATCGATGAAATTAAAGAACATTCCTACCAGATAACAACATTGTCAGAGTTTGAATATATTGATCGTACTGGGAGGGATCAAGGGAACAATGTAAGAAAGAAGTCGCAAAGTCTTGTGGCTTTAGTCAATGACAAAGAAAAGATACA...

Protein

Download Protein FASTA

107 aa · TkA03G379200|TK1151|PROTEIN

MIMSIIWKRVNDTGKNWRHVYKGLTVLEYLVANGSERVIDEIKEHSYQITTLSEFEYIDRTGRDQGNNVRKKSQSLVALVNDKEKIQEVRKKNCCQLRQASFYKKKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G379200`
TK1151 ID	TkA03G379200
OH-1004 ID	LXL04_033187
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.700
Protein coverage (%)	TK1151 85.981 / OH-1004 12.940 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G379200

Location Chr03:93522628-93523111 (+)

Description Similar to EPSIN2: Clathrin interactor EPSIN 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q67YI9`	May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes.	No verified direct reference in this release
`At3g59290`	Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2).	No verified direct reference in this release
`At5g11710`	May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes.	Arabidopsis EPSIN1 plays an important role in vacuolar trafficking of soluble cargo proteins in plant cells via interactions with clathrin, AP-1, VTI11, and VSR1.2006 · DOI: 10.1105/tpc.105.039123

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033187 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006897 endocytosis Biological Process

GO:0015031 protein transport Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005884 actin filament Cellular Component

KEGG gene cross-reference

ath:AT2G43160

ath:AT3G59290

ath:AT5G11710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA03G379200 · TK1151

Nucleus0.274

Rank 2 · TkA03G379200 · TK1151

Mitochondrion0.122

Rank 3 · TkA03G379200 · TK1151

Cell membrane0.055

Rank 4 · TkA03G379200 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA03G379200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01417ENTH2-85 aa

PF00790VHS3-77 aa

PF07651ANTH5-70 aa

PF20763UDG-inhib_P5610-44 aa

PF19805DUF628813-49 aa

PF08862DUF182934-94 aa

PF20763UDG-inhib_P5650-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G379200	`PF01417`	ENTH	2	85	1.5e-33	116.2
TkA03G379200	`PF00790`	VHS	3	77	0.00086	19.9
TkA03G379200	`PF07651`	ANTH	5	70	0.005	16.6
TkA03G379200	`PF20763`	UDG-inhib_P56	10	44	0.01	16.3
TkA03G379200	`PF19805`	DUF6288	13	49	0.094	12.7
TkA03G379200	`PF08862`	DUF1829	34	94	0.07	14.4
TkA03G379200	`PF20763`	UDG-inhib_P56	50	58	0.01	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67YI9`	Arabidopsis thaliana	sp\|Q67YI9\|EPN2_ARATH Clathrin interactor EPSIN 2	77.200%	Swiss-Prot	High
`Q93YP4`	Arabidopsis thaliana	sp\|Q93YP4\|EPN3_ARATH Clathrin interactor EPSIN 3	74.400%	Swiss-Prot	High
`Q8VY07`	Arabidopsis thaliana	sp\|Q8VY07\|EPN1_ARATH Clathrin interactor EPSIN 1	57.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card