TkA03G371340 | RubberDandelionOmics

Gene overview

TkA03G371340

Reference: TK1151 Chr: Chr03 Coordinates: 91570976-91572086 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

713 bp · TkA03G371340|TK1151|cDNA

ATGGGCACAATTCAACCCATGAATGGTCATGGCATCTCTTCAGTCTCACACTCTTTCTGTTCCAACTTCAACTACACCAGTTTCGCCATTCAAAGACCCTCCACCAAGTGCCACAATTACTCTAGGTCAAAATTCCGAGCCATGACCACCGTACGCGACGGTCAATCTGAAACCGCACCACCACAAGAACCCCCTTCCGTCAATTTCGCTTTCGGCAGTCGGGTGCTGCTACCGGATGGAACTCCCGACGTACATTTTAG...

CDS

Download CDS FASTA

588 bp · TkA03G371340|TK1151|CDS

ATGGGCACAATTCAACCCATGAATGGTCATGGCATCTCTTCAGTCTCACACTCTTTCTGTTCCAACTTCAACTACACCAGTTTCGCCATTCAAAGACCCTCCACCAAGTGCCACAATTACTCTAGGTCAAAATTCCGAGCCATGACCACCGTACGCGACGGTCAATCTGAAACCGCACCACCACAAGAACCCCCTTCCGTCAATTTCGCTTTCGGCAGTCGGGTGCTGCTACCGGATGGAACTCCCGACGTACATTTTAG...

Protein

Download Protein FASTA

195 aa · TkA03G371340|TK1151|PROTEIN

MGTIQPMNGHGISSVSHSFCSNFNYTSFAIQRPSTKCHNYSRSKFRAMTTVRDGQSETAPPQEPPSVNFAFGSRVLLPDGTPDVHFRTATGGQKLRDIMLDSNMELYGPYSRPLLNCAGGGTCGTCMVEVIEGKELLTPRTDKEKEKLNRNPKNWRLACQTTVGKPDSTGLVVIQQLPEWKEHEWTLGKEPPVES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G371340`
TK1151 ID	TkA03G371340
OH-1004 ID	LXL04_008452
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G371340

Location Chr03:91570976-91572086 (-)

Description Similar to PNSB3: Photosynthetic NDH subunit of subcomplex B 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16250`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008452 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0022900 electron transport chain Biological Process

GO:0140647 P450-containing electron transport chain Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone) Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT3G16250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA03G371340 · TK1151

Mitochondrion0.028

Rank 2 · TkA03G371340 · TK1151

Nucleus0.013

Rank 3 · TkA03G371340 · TK1151

Cytoplasm0.012

Rank 4 · TkA03G371340 · TK1151

Cell membrane0.010

Rank 5 · TkA03G371340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00111Fer2116-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G371340	`PF00111`	Fer2	116	163	7.2e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU21`	Arabidopsis thaliana	sp\|Q9LU21\|PNSB3_ARATH Photosynthetic NDH subunit of subcomplex B 3, chloroplastic	71.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card