TkA03G371290 | RubberDandelionOmics

Gene overview

TkA03G371290

Reference: TK1151 Chr: Chr03 Coordinates: 91559933-91561560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkA03G371290|TK1151|cDNA

TTAAATTAACCGAAAAAAAGAATATATTCTTGTATCAACGATCATTATAACTTAGAAAATTTTAGTATATAAAGCCTCTTCAGTGTTGTGTATAGATCGCTATATTCAAACATTCTCCTCTCTTTCTATCTCCATTATTTTTCCAAATTAAGCTTATAACTATCAGTTAATAGAAAAAATGCCAGGAATCGCCGTTGGTAGTTTGGGTGATTCCTTCAGTGGCAGCTCGATCAAGGCCTACATTGCTGAGTTCATCTCCA...

CDS

Download CDS FASTA

318 bp · TkA03G371290|TK1151|CDS

ATGGAAATCGTCATCACATTTGCTTTGGTGTACACAGTATACGCCACCGCATGTGACCCAAAGAAGGGTTCAGTAGGCACAATTGCGCCAATGGCAATCGGGTTCATCGTTGGTGCCAATATTTTGGCAGCAGGCCCATTCTCCGGTGGATCAATGAACCCAGCTAGATCATTTGGACCTGCTGTAGCCAGTTTTGATTTTGCTGGACACTGGATCTACTGGGTTGGACCACTCATCGGTGGTGGTTTAGCCGGAGCAAT...

Protein

Download Protein FASTA

105 aa · TkA03G371290|TK1151|PROTEIN

MEIVITFALVYTVYATACDPKKGSVGTIAPMAIGFIVGANILAAGPFSGGSMNPARSFGPAVASFDFAGHWIYWVGPLIGGGLAGAIYPNVFFSNDEHIPLANEY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G371290`
TK1151 ID	TkA03G371290
OH-1004 ID	LXL04_008453
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 42.339 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G371290

Location Chr03:91559933-91561560 (+)

Description Similar to TIP2-1: Aquaporin TIP2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16240`	Aquaporin required to facilitate the transport of water from the vacuolar compartment to the cytoplasm.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0658100`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0032586 protein storage vacuole membrane Cellular Component

GO:0042807 central vacuole Cellular Component

KEGG gene cross-reference

ath:AT3G16240

ath:AT5G47450

dosa:Os02g0658100

zma:541895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.462

Rank 1 · TkA03G371290 · TK1151

Lysosome / Vacuole0.326

Rank 2 · TkA03G371290 · TK1151

Cytoplasm0.128

Rank 3 · TkA03G371290 · TK1151

Endoplasmic reticulum0.096

Rank 4 · TkA03G371290 · TK1151

Mitochondrion0.051

Rank 5 · TkA03G371290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP1-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G371290	`PF00230`	MIP	1	88	4e-35	122.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q41951`	Arabidopsis thaliana	sp\|Q41951\|TIP21_ARATH Aquaporin TIP2-1	83.500%	Swiss-Prot	High
`Q7XA61`	Oryza sativa subsp. japonica	sp\|Q7XA61\|TIP21_ORYSJ Probable aquaporin TIP2-1	78.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card