TkA03G369680 | RubberDandelionOmics

Gene overview

TkA03G369680

Reference: TK1151 Chr: Chr03 Coordinates: 91190136-91194757 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2707 bp · TkA03G369680|TK1151|cDNA

TCATTTCCCCTCGAATATAAAAATAAACGCTTTGGCTAGAGTAATAAGAGACTCCATATTAGAGTTTTTCATTCAGTCACGAACCTTCATTTTACCGTTGTTGTGTTACGGCGAGGCAAAAGGCTAAGAGCATACATATGTCCTTGGCGCTCGAATTTATCGTATGCTCCTACGTACTCTATTTTATCTAATCTTTCCTTCATCACGAAAAACTTTTGTCTCTTCCCAGTGATGACGATCAAGGAAAGAAACGTGGAAAA...

CDS

Download CDS FASTA

1773 bp · TkA03G369680|TK1151|CDS

ATGAACAGATGCTCTCCATTTATTACCATCCTCCATAATAACTGCAACCAGAAGGTCTTGTTCTTCAACTACTTCCTTACCCACTATAAGCCTCCTTTCACTTCTAGCTTCCCTCAGTCTCGTCGAATTTCAGGTTGTAGAACATTCATGGAGGTTGTCAAAGCAATTGCTGGTCACGGATCCGCTTCTCATCAAAACATTGCTCTTAAAGCCGATGACAAAAGCTACGCCTACAATCATTTAATTTCATCTGCTTCAAA...

Protein

Download Protein FASTA

590 aa · TkA03G369680|TK1151|PROTEIN

MNRCSPFITILHNNCNQKVLFFNYFLTHYKPPFTSSFPQSRRISGCRTFMEVVKAIAGHGSASHQNIALKADDKSYAYNHLISSASNISLLLSTHNQKTVDETKENKNLNGARIGIVAKPSAEFVAGVLAIWLSGGVAVPLALSYPEAELLHVMTDSDVSMILSTEDHKELMQQVADKTSAQFSLIPNVPSITSQAVDNGVHQKEILFENKVKDDNPALILYTSGTTGKPKGVVHTHSSILAQVKTLSTAWEYTSNDRFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G369680`
TK1151 ID	TkA03G369680
OH-1004 ID	LXL04_008463
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G369680

Location Chr03:91190136-91194757 (+)

Description Similar to AAE13: Malonate--CoA ligase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16170`	Malonate--CoA ligase that catalyzes the formation of malonyl- CoA directly from malonate and CoA.	Malonyl-CoA synthetase, encoded by ACYL ACTIVATING ENZYME13, is essential for growth and development of Arabidopsis.2011 · DOI: 10.1105/tpc.111.086140

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008463 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process

GO:0090410 malonate catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0031956 medium-chain fatty acid-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT3G16170

bta:509209

hsa:197322

mmu:257633

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.808

Rank 1 · TkA03G369680 · TK1151

Cytoplasm0.081

Rank 2 · TkA03G369680 · TK1151

Peroxisome0.072

Rank 3 · TkA03G369680 · TK1151

Plastid0.068

Rank 4 · TkA03G369680 · TK1151

Nucleus0.039

Rank 5 · TkA03G369680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding111-438 aa

PF28687STR4A_N124-145 aa

PF13193AMP-binding_C490-575 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G369680	`PF00501`	AMP-binding	111	438	1.9e-70	238.3
TkA03G369680	`PF28687`	STR4A_N	124	145	0.2	11.9
TkA03G369680	`PF13193`	AMP-binding_C	490	575	7.5e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H151`	Arabidopsis thaliana	sp\|Q8H151\|AAE13_ARATH Malonate--CoA ligase	69.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card