TkA03G367880 | RubberDandelionOmics

Gene overview

TkA03G367880

Reference: TK1151 Chr: Chr03 Coordinates: 90738303-90741691 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2139 bp · TkA03G367880|TK1151|cDNA

AGAAAAGAAAAAGAAGAAAAAGGGGACAATCCAAACATGAATCCCGTTAGTCACTGCACGTCGCACGGGAAGATAAAAGCAGTGTTGCTTCCACTCCTCCGCCCTTTTTGTTTCATTTTCATACAGAGATCTTAGACTCTTGAACAAATCTCTCCCTCCAAACAAACTTTACTAAACGTCAACAGAAAATCGTGATTCTTAATCGACCTCCTCATTGATCAATTCAGATCTCAATCACAATTCACATTGATCTCTTTGCC...

CDS

Download CDS FASTA

732 bp · TkA03G367880|TK1151|CDS

ATGATAACACTCAAAGGGCTATCGATGGAAATGAGTATGTTTTTGGTACTGGGTTATGCTCCTTGGTGCGTAAGAAGTGCTGAACTAATGCCTAGGTTTGCAGAAGCTGCTAGCTCGTTGAATGAATTAAAGAGTCCCCTTTTAATGGCGAAGATCGATGCAGAGAGGTACCCAAAAGTAGCTTCGAATCTTGCGATCAAAGGATACCCGACCTTGCTTCTCTTTGTCAATGGCACTTCTCAACCTTACACCGGTGGATT...

Protein

Download Protein FASTA

243 aa · TkA03G367880|TK1151|PROTEIN

MITLKGLSMEMSMFLVLGYAPWCVRSAELMPRFAEAASSLNELKSPLLMAKIDAERYPKVASNLAIKGYPTLLLFVNGTSQPYTGGFSTEEIVIWARKKTGTPIIRINSFDEANNFLKKHSMFTIGVFDKFEGPDYDEFVKAATTDNDIQFVETNSRKIANLLYPDVKSDNLFLGIVKSEPERYTSYAFAEGDFKKDKILQFLNDNKFPLVTFLSELIILSKFTPAINYRFTSLQKLMNSRNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G367880`
TK1151 ID	TkA03G367880
OH-1004 ID	LXL04_008479
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.500
Protein coverage (%)	TK1151 83.539 / OH-1004 37.807 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G367880

Location Chr03:90738303-90741691 (-)

Description Similar to PDIL1-6: Protein disulfide isomerase-like 1-6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16110`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release
`At1g52260`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0163400`	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0003756 protein disulfide isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G52260

ath:AT3G16110

ath:AT3G54960

ath:AT5G60640

dosa:Os06g0163400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.352

Rank 1 · TkA03G367880 · TK1151

Cytoplasm0.229

Rank 2 · TkA03G367880 · TK1151

Extracellular0.146

Rank 3 · TkA03G367880 · TK1151

Mitochondrion0.122

Rank 4 · TkA03G367880 · TK1151

Nucleus0.118

Rank 5 · TkA03G367880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085Thioredoxin11-95 aa

PF04756OST3_OST623-117 aa

PF01216Calsequestrin49-163 aa

PF13848Thioredoxin_659-116 aa

PF13848Thioredoxin_6128-215 aa

PF00085Thioredoxin136-156 aa

PF04756OST3_OST6184-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G367880	`PF00085`	Thioredoxin	11	95	4.5e-13	49.8
TkA03G367880	`PF04756`	OST3_OST6	23	117	0.023	14.8
TkA03G367880	`PF01216`	Calsequestrin	49	163	0.03	14.1
TkA03G367880	`PF13848`	Thioredoxin_6	59	116	1.7e-07	32.1
TkA03G367880	`PF13848`	Thioredoxin_6	128	215	1.7e-07	32.1
TkA03G367880	`PF00085`	Thioredoxin	136	156	4.5e-13	49.8
TkA03G367880	`PF04756`	OST3_OST6	184	205	0.023	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GQ3`	Arabidopsis thaliana	sp\|Q66GQ3\|PDI16_ARATH Protein disulfide isomerase-like 1-6	64.000%	Swiss-Prot	High
`A3KPF5`	Arabidopsis thaliana	sp\|A3KPF5\|PDI15_ARATH Protein disulfide isomerase-like 1-5	61.900%	Swiss-Prot	High
`Q5WA72`	Oryza sativa subsp. japonica	sp\|Q5WA72\|PDI15_ORYSJ Protein disulfide isomerase-like 1-5	50.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card