TkA03G348350 | RubberDandelionOmics

Gene overview

TkA03G348350

Reference: TK1151 Chr: Chr03 Coordinates: 85719455-85721716 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2126 bp · TkA03G348350|TK1151|cDNA

ATTAGAAGATGTCACTATGTCACCGACAATTTCTGATCAAGGCACGACGTGCTGCCGATCTATTCAACACTCACCGTCAAACCCATTTTCTATAGTACCATAAAACAACGACAGTCGCGATCTTTTACTCCGATTTATCAAAACACACCCACACCACACACACCTACAAGTCCATCGATTTGAACTATTTACTCGACAAAACGAAGCGACTGATTTATCAGTCTACATCTTTGAGTATTCTTCACCGTTCTTCTCGCACC...

CDS

Download CDS FASTA

747 bp · TkA03G348350|TK1151|CDS

ATGAGAAGATTGAACAAAAATTACGGCGATCCACCCACATATTCCGGTCTCGGAGGCGACAGTATATGCCGGGATCAACAAACGAGATTTGGGTCGAGTCCTTTGAAATTAATGGGTTGTTTTGTCGTCTGCTTGATGGGTCTATCGGTTTTGTTCTCGATTTCTATAATTTTGAAGGATTCCACACCAACGAGCATCTGGGCTGTAGCTGATGCTAGAGTTCTTGATATGCCCCCTCCTAGAGATTTAGGTCAAGAAGA...

Protein

Download Protein FASTA

248 aa · TkA03G348350|TK1151|PROTEIN

MRRLNKNYGDPPTYSGLGGDSICRDQQTRFGSSPLKLMGCFVVCLMGLSVLFSISIILKDSTPTSIWAVADARVLDMPPPRDLGQEDEPMDSFAQHKKKLHSAGFEHEDKLLGGLLSSRFDQDSCLSRYESASFRKESPYKPSSDLISKLRRYEALHKRCGPYTESYNRTVAKLSSGEMIGEPSDCNYLIWVSFSGLGNRILTLGSAFVYALLTDRVLLVDRGADMDDLFCEPFPEVSCDFPMINSTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G348350`
TK1151 ID	TkA03G348350
OH-1004 ID	LXL04_008659
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 43.373 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G348350

Location Chr03:85719455-85721716 (+)

Description Similar to FT1: Galactoside 2-alpha-L-fucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03220`	Involved in cell wall biosynthesis.	The mur2 mutant of Arabidopsis thaliana lacks fucosylated xyloglucan because of a lesion in fucosyltransferase AtFUT1.2002 · DOI: 10.1073/pnas.052450699 The galactose residues of xyloglucan are essential to maintain mechanical strength of the primary cell walls in Arabidopsis during growth.2004 · DOI: 10.1104/pp.103.027508 Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At1g74420`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At1g14070`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At1g14100`	May be involved in cell wall biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009969 xyloglucan biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0008107 galactoside 2-alpha-L-fucosyltransferase activity Molecular Function

GO:0008417 fucosyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G14100

ath:AT2G03210

ath:AT2G03220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.766

Rank 1 · TkA03G348350 · TK1151

Endoplasmic reticulum0.105

Rank 2 · TkA03G348350 · TK1151

Cell membrane0.060

Rank 3 · TkA03G348350 · TK1151

Cytoplasm0.057

Rank 4 · TkA03G348350 · TK1151

Nucleus0.050

Rank 5 · TkA03G348350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03254XG_FTase104-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G348350	`PF03254`	XG_FTase	104	242	1.2e-61	209.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SWH5`	Arabidopsis thaliana	sp\|Q9SWH5\|FUT1_ARATH Galactoside 2-alpha-L-fucosyltransferase	51.300%	Swiss-Prot	High
`Q9CA71`	Arabidopsis thaliana	sp\|Q9CA71\|FUT3_ARATH Fucosyltransferase 3	44.800%	Swiss-Prot	Medium
`Q9XI81`	Arabidopsis thaliana	sp\|Q9XI81\|FUT7_ARATH Probable fucosyltransferase 7	58.700%	Swiss-Prot	Medium
`Q9XI78`	Arabidopsis thaliana	sp\|Q9XI78\|FUT8_ARATH Probable fucosyltransferase 8	58.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card