TkA03G338700 | RubberDandelionOmics

Gene overview

TkA03G338700

Reference: TK1151 Chr: Chr03 Coordinates: 83302460-83303350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

693 bp · TkA03G338700|TK1151|cDNA

ATGTCGACAAAAAGACAAAAGCAGTTTGTACATTACATGGAGAAGACGAATTGTCATTGTATTTGGGTCATCAACGTGAATACACTGAAAAAAGGTCTGTATCTATGGAACCCTTCGATCAGATGCAAACTAAGTGTGCCTCAAAGTCGTATTAGATATGGACATCAGCATGCAATTGGGTTTGGATTCGACCCAATCAGTGATGATTACAAAATTGTCCACATAACGGATGCCAAAGATATTGCATTTGTGTATGCTCT...

CDS

Download CDS FASTA

693 bp · TkA03G338700|TK1151|CDS

ATGTCGACAAAAAGACAAAAGCAGTTTGTACATTACATGGAGAAGACGAATTGTCATTGTATTTGGGTCATCAACGTGAATACACTGAAAAAAGGTCTGTATCTATGGAACCCTTCGATCAGATGCAAACTAAGTGTGCCTCAAAGTCGTATTAGATATGGACATCAGCATGCAATTGGGTTTGGATTCGACCCAATCAGTGATGATTACAAAATTGTCCACATAACGGATGCCAAAGATATTGCATTTGTGTATGCTCT...

Protein

Download Protein FASTA

230 aa · TkA03G338700|TK1151|PROTEIN

MSTKRQKQFVHYMEKTNCHCIWVINVNTLKKGLYLWNPSIRCKLSVPQSRIRYGHQHAIGFGFDPISDDYKIVHITDAKDIAFVYALKTGAWCKIASSKPEYTYVLSHKAYFSDGVLYWEVRHLVESKDAYLLTFDLSSNVFGMIPLPGVTWNWTSTASTTIQGCLAFVCYGYVLDDSWVWVWKDASWSIVYKLNINHTIVTKALQLQSQSQSTTNDVETLYLLDIGETV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G338700`
TK1151 ID	TkA03G338700
OH-1004 ID	LXL04_008745
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.800
Protein coverage (%)	TK1151 87.391 / OH-1004 67.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G338700

Location Chr03:83302460-83303350 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G16210

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · TkA03G338700 · TK1151

Nucleus0.371

Rank 2 · TkA03G338700 · TK1151

Cell membrane0.135

Rank 3 · TkA03G338700 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA03G338700 · TK1151

Lysosome / Vacuole0.055

Rank 5 · TkA03G338700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_312-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G338700	`PF08268`	FBA_3	12	189	6.8e-19	68.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU24`	Arabidopsis thaliana	sp\|Q9LU24\|FB145_ARATH Putative F-box protein At3g16210	33.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card