Gene Card
Gene overview
cDNA / CDS / Protein Sequences
451 bp · TkA03G338620|TK1151|cDNA
TTCAAGGGATGCTGCTGCTGTTTTTTTGGGCTGTTAGTTTGTCGCTGGAAAAGCTGTTTGGCATTCTGCTGATGGTTGTGGTTAAGTTTGTTAAATTTCTGCAGACCCGAGGGCATTTTTGGCATACTTTTGATGTTTGGCAGCCGGGTGTTTGCATTGAGTTCTGGCATCTTAAAGCCAGCAGGGTCATTAACTGCATTATTTTCTGGAAAATCTGTTACAAGAATTGCGGGTTTTTAAAATTGTTGCTGGTTTTTAAA...
333 bp · TkA03G338620|TK1151|CDS
ATGCTGCTGCTGTTTTTTTGGGCTGTTAGTTTGTCGCTGGAAAAGCTGTTTGGCATTCTGCTGATGGTTGTGGTTAAGTTTGTTAAATTTCTGCAGACCCGAGGGCATTTTTGGCATACTTTTGATGTTTGGCAGCCGGGTGTTTGCATTGAGTTCTGGCATCTTAAAGCCAGCAGGGTCATTAACTGCATTATTTTCTGGAAAATCTGTTACAAGAATTGCGGGTTTTTAAAATTGTTGCTGGTTTTTAAAAGGTCCAG...
Protein
Download Protein FASTA110 aa · TkA03G338620|TK1151|PROTEIN
MLLLFFWAVSLSLEKLFGILLMVVVKFVKFLQTRGHFWHTFDVWQPGVCIEFWHLKASRVINCIIFWKICYKNCGFLKLLLVFKRSSLILNAEGSFGISGYGRAIRDKGT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G338620 |
|---|---|
| TK1151 ID | TkA03G338620 |
| OH-1004 ID | LXL04_008746 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.100 |
| Protein coverage (%) | TK1151 77.273 / OH-1004 29.210Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G338620 |
|---|---|
| Location | Chr03:83276262-83276808 (+) |
| Description | Similar to CDKD-1: Cyclin-dependent kinase D-1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0030154 cell differentiation Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process GO:0051301 cell division Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0070985 transcription factor TFIIK complex Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G18040 ath:AT1G66750 ath:AT1G73690 dosa:Os05g0392300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.